DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrdc1a

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_005171840.1 Gene:arrdc1a / 100006005 ZFINID:ZDB-GENE-030925-15 Length:447 Species:Danio rerio


Alignment Length:445 Identity:111/445 - (24%)
Similarity:185/445 - (41%) Gaps:88/445 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYA-------ETHWTESKTDSNNKS 63
            :|.|.|| :.|:..|:.:.|.:.:|..::||.|||::..:|:.       :|.||:.        
Zfish     8 EITFDNN-KTVYSPGESLTGTLKISIAQSIQCKAIKVNCQGFCGVTSKSNDTDWTDE-------- 63

  Fly    64 TSESYNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNI 128
                    |:|.||.|     .|:.:..|:.|..|:.|...:|...|:||.|.:|:|.|.|...|
Zfish    64 --------EQYFSSSV-----SIADKGTLKEGEHSFPFKFLLPAAAPTSFVGPYGQIMYRVRAFI 115

  Fly   129 IQP-WKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVP 192
            ..| :..|....:.|::...:::|....:.: |..:...|.|.....::..:.|.......|::.
Zfish   116 DTPRFAKDYKIEKPFSMTNTLNLN
EVPGIRE-PSSSSVTKNFSYMLVKNGTVVLNAKTDMRGYIA 179

  Fly   193 GQTVPANVLIGNESKIRVHEVKVGLSMMITYYS-----DLSSGSKCERKSVAKLKADGVLRNSRK 252
            ||.:..:..|.|:|......|...|...:||.:     ||        :|||:::..||...::.
Zfish   180 GQIIKVSAGIENKSDKTTGHVVASLMQKVTYNTKKPTYDL--------RSVAEVEGPGVKGGNKS 236

  Fly   253 MYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPS-------- 309
            .::.|:::|:.|.|......:|:|.|.|:|..|...:    .|.:|:.|..|.:.||        
Zfish   237 EWNQQIIVPALPHSSLSDGNLIQICYYIQVYLKYPEV----ALTLPICIGSVALDPSQPSHSQTV 297

  Fly   310 ----AVQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWS-EGSTLSPP-----------NYA 358
                |.:.||..| |.|||..|..| ....|..||..|.|.| ..|..:||           ||.
Zfish   298 APMPAPRITPAPS-PSAPESEASNL-PPRPAPKPAPKPRPRSTHASPSAPPVDLYPQLPSVSNYN 360

  Fly   359 EAMHSHSDSEKQSE---SGNA-----------QEKSYKPLYPVFDLSTSTVEKSK 399
            ..|......|..|:   |.||           ::.|..|..|...||:|:.::::
Zfish   361 GEMLKSPHQEPGSQGPVSPNAFSYAPGLSFRQRQSSSGPSAPPPSLSSSSQDRNQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 40/152 (26%)
Arrestin_C 175..301 CDD:280848 30/130 (23%)
arrdc1aXP_005171840.1 Arrestin_N 7..139 CDD:304627 40/152 (26%)
Arrestin_C 162..283 CDD:280848 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.