DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18747 and Txnip

DIOPT Version :10

Sequence 1:NP_652650.2 Gene:CG18747 / 59143 FlyBaseID:FBgn0042104 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:86 Identity:24/86 - (27%)
Similarity:30/86 - (34%) Gaps:26/86 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LELSAINMLIFLSLFLFFFV--------IFIACEIYLHCVAKPMDYFS----------EAKKLNE 48
            |.:|.|....||:..:.|.|        :....|:|...|.   .|||          |.|..:.
Mouse   279 LPISMIYFFAFLTEMVHFVVGRIYNFQPLLTRTEVYKTGVT---HYFSMRKAREELGYEPKLYDL 340

  Fly    49 EDV-----KRNHGTKSGRVGI 64
            |||     .|.||.|..|..|
Mouse   341 EDVVQWFQARGHGKKRSRSSI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18747NP_652650.2 Arrestin_N 5..152 CDD:425619 23/83 (28%)
Arrestin_C 176..307 CDD:214976
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:451447
Arrestin_C 175..299 CDD:460676 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.