DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18747 and ZK938.11

DIOPT Version :10

Sequence 1:NP_652650.2 Gene:CG18747 / 59143 FlyBaseID:FBgn0042104 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:64 Identity:17/64 - (26%)
Similarity:33/64 - (51%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HRLTIEAGVHSYNFTCQLPYQCPSSFEGRHGCIRYIVKVLLIRPWKFDQAYTKGFTVLKMLDLN 152
            ::|.:|....|:.|  |:|.....:::..|  |:|.:.:.:.||||.:....|...|.:.||::
 Worm    28 NKLPVELLEKSFEF--QIPTGSRLTYKAGH--IKYTMSLEVDRPWKTNLKVKKEVIVARKLDVD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18747NP_652650.2 Arrestin_N 5..152 CDD:425619 17/62 (27%)
Arrestin_C 176..307 CDD:214976
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.