DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ARRDC4

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_899232.2 Gene:ARRDC4 / 91947 HGNCID:28087 Length:418 Species:Homo sapiens


Alignment Length:390 Identity:84/390 - (21%)
Similarity:159/390 - (40%) Gaps:70/390 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGE-SFNGHV 71
            |.:..:|.:.:|:.::|.|:::..:..:::|:.|..:|.|...|..:.......|... :....|
Human    24 FEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAWGPSTCPRASASTAALAVFSEV 88

  Fly    72 DYLATRAYLH--GSSSSIEVLIEPGTSSYRFACQLP----ITCPSSFEGTLGRIRYLVNVRFVRP 130
            :||..|..|.  .:...| :|::||...:.|..|||    :|   ||.|..|.|:|.|.....||
Human    89 EYLNVRLSLREPPAGEGI-ILLQPGKHEFPFRFQLPSEPLVT---SFTGKYGSIQYCVRAVLERP 149

  Fly   131 WKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIV 195
            ...|.:..|...|:..:|:|:.:|:  .|.....::...|:...|.|:|:...:.:.|:..|:.:
Human   150 KVPDQSVKRELQVVSHVDVNTPALL--TPVLKTQEKMVGCWFFTSGPVSLSAKIERKGYCNGEAI 212

  Fly   196 PVEVMVSNDSGVAVEDITVKLTMVVIYYSQP--PSADTNKDRFEMVLKTGGGVSTKCRQQFT-FD 257
            |:...:.|.|...:      :....|:.:|.  .|..|...|..:....|..:::.....:. ..
Human   213 PIYAEIENCSSRLI------VPKAAIFQTQTYLASGKTKTIRHMVANVRGNHIASGSTDTWNGKT 271

  Fly   258 LKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP----------LTKQLQK 312
            ||:||..|:..: |.||::.|.:.....:.|.. ...|.:|:.||::|          :..|...
Human   272 LKIPPVTPSILD-CCIIRVDYSLAVYIHIPGAK-KLMLELPLVIGTIPYNGFGSRNSSIASQFSM 334

  Fly   313 EPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAE-------AKHISPDP 370
            : .:|..:..|:|.:                            |||:||:       ::||.|.|
Human   335 D-MSWLTLTLPEQPE----------------------------APPNYADVVSEEEFSRHIPPYP 370

  Fly   371  370
            Human   371  370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 38/148 (26%)
Arrestin_C 174..306 CDD:214976 29/144 (20%)
ARRDC4NP_899232.2 Arrestin_N 26..169 CDD:278754 37/146 (25%)
Arrestin_C 191..318 CDD:214976 28/134 (21%)
PPxY motif 1. /evidence=ECO:0000305 350..353 2/2 (100%)
PPxY motif 2. /evidence=ECO:0000305 395..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.