DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and CSR2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_015355.1 Gene:CSR2 / 856142 SGDID:S000006234 Length:1121 Species:Saccharomyces cerevisiae


Alignment Length:395 Identity:86/395 - (21%)
Similarity:131/395 - (33%) Gaps:91/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DQSNGESFNGHVDYLATRAYLHGSSSSIEVLIEPG--TSSYRFACQLPITCPSSFEGTLGRIRYL 122
            :.|||.|.|            :|:|||...:....  |.:.::...|..|.|.....|..:..|:
Yeast   582 NNSNGRSDN------------NGASSSGLAMQHDSEDTINLQYPLNLVRTPPEISVTTANKPLYI 634

  Fly   123 VNVRFVRPWKFDLNFNRCFTVIKVMDLNSE-SLMLRVPSQVESQ-----RTFC------------ 169
            ..|     |:..|::...|.. |.:.||.| .:.::|...|:|.     |..|            
Yeast   635 NKV-----WENCLSYEISFAQ-KYVPLNGEIPITIKVAPLVKSLSVKRIRVSCREKISYRSKDYQ 693

  Fly   170 ----------CFPCRSSPLSMRLSVPQSGFVPGQIVPV-EVMVSNDSGVAVEDITVKLTM---VV 220
                      ..||  :|..||..|.:.   ..:.:|: ||.....||.::.:..|..|:   ::
Yeast   694 YDFDQLDPLASDPC--NPYHMRYLVRKK---KDRSLPLFEVASKCTSGPSIREEVVTNTVDDNLL 753

  Fly   221 IYYSQPPSADTNKDRFEMVLKTGGGVSTK------CRQQFTFDLKVPPTPPTCFNLCSIIQIGYQ 279
            .|.|   |.:.|||   :.......|.||      |....|   |....||...:|...|:...|
Yeast   754 AYTS---SKENNKD---IPFSESFTVKTKLKFPKYCEVDAT---KAASLPPYGIDLFDPIKDPTQ 809

  Fly   280 VE---AEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGE 341
            .|   ....|.|...|:......|:..:|..|...:...|.|......|..:...|     |:..
Yeast   810 SENTSNNGNVLGFLVGRPNRASKTVHKIPQDKNHNEVNDTNGNSNTSLQTSSNVPI-----QHYT 869

  Fly   342 ALGSPNPWAADPSIAPPSYAEAKHIS--PDPHKFSKSKKKSQKRGVKGSQERKAETIVFSPLYAV 404
            .|..|....         |.::.|..  ...||.....:.|:.........|..|.||.:|:|.:
Yeast   870 RLNKPRRGL---------YLDSMHFKNIQCSHKLEIVLRVSKTDSGSSKIIRHYEVIVDTPIYLI 925

  Fly   405 FDLSN 409
            .||.|
Yeast   926 SDLCN 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 20/91 (22%)
Arrestin_C 174..306 CDD:214976 33/144 (23%)
CSR2NP_015355.1 Arrestin_C 638..>737 CDD:214976 22/104 (21%)
Arrestin_C <828..926 CDD:413500 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.