DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and LDB19

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_014967.3 Gene:LDB19 / 854500 SGDID:S000005849 Length:818 Species:Saccharomyces cerevisiae


Alignment Length:514 Identity:97/514 - (18%)
Similarity:174/514 - (33%) Gaps:172/514 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AGQLISGQVVI------KTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSN-GESFNGHVDYL- 74
            :|.::||...:      .:.::||:|        ..|::.:.|......:|. |.:.:..:..| 
Yeast    50 SGAVLSGLFTVTVVDPYSSAEDKSLK--------NTESNVSTTSKSLKRKSTFGSALSSRLSSLS 106

  Fly    75 ATRAYLHGSSSSIEVLIEPGTSSYR-FACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFN 138
            |:.:.:..|:||..:...|..::.| .|....||..|.   ||..::   .:.|.:|:       
Yeast   107 ASTSNISPSTSSTSISHSPTPANLRIMAGYTKITITSV---TLSLVQ---KIHFHKPF------- 158

  Fly   139 RCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMR----------LSVPQSGFVPGQ 193
                               ||: :.|.:|  |..|::...:|:          |||....:....
Yeast   159 -------------------VPN-ISSMQT--CMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSY 201

  Fly   194 IVPVEVMVSNDSGVAVE-DITVKLTMVVIYYSQPPSADTNKDRFEMVLKT---GGGVSTKCRQQF 254
            ::|..|..|:..|...| .:..:|..||.|      .|.:::.|.....|   .|..|.|...|.
Yeast   202 LIPGSVPCSSSLGATAETQVKYELIAVVTY------IDPHRNSFSSGHSTPRKEGSSSKKRLLQL 260

  Fly   255 TFDLKV----------------PPT-------------PPTCFNL-------------CSIIQIG 277
            ...:.|                |||             |.:.|.|             ..:.::.
Yeast   261 AMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWRMRKLS 325

  Fly   278 YQVEAEARVK--GC----HGGQSLHMPITIGSVPLTKQLQKEPRTWGEV-------------LPP 323
            :::|...|||  .|    |..:.|...:.|.....:|:.:...:.:||:             :|.
Yeast   326 WRIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSHIKRYGELGPQIRVAVNSLENMPS 390

  Fly   324 QQLDAKALILIGSEQ----NGEA------LGSPNPWAADPSIAPPSYAEAKHISPDPHKFSKSKK 378
            |:|..:.    |.||    :|.|      |...||...|....|.|  |..|.|.|..:.....:
Yeast   391 QRLPGEP----GREQAPNSSGPASTGNVGLDDENPVNEDEEDQPGS--EFIHPSDDALRQELLMQ 449

  Fly   379 KSQKRGVKGSQERKAETIVFSPLYAVFDLSNQVDEMTLRANEPKTDGGYVNEGVEKSTW 437
            :.:.|..:..||.|..:.:|:            :|:.:           :::|..||.|
Yeast   450 QQRARQQQLQQELKNNSSLFT------------EEVRI-----------ISKGEMKSGW 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 25/140 (18%)
Arrestin_C 174..306 CDD:214976 35/193 (18%)
LDB19NP_014967.3 LDB19 144..346 CDD:404030 43/242 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.