DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ART5

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_011582.1 Gene:ART5 / 852960 SGDID:S000003300 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:82/451 - (18%)
Similarity:160/451 - (35%) Gaps:128/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNSQGIFYAGQLI--SGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHD-----PDDQSNGESF 67
            |:|.|...:.|.:  ||..:..:  ::|:.:.:.|.....:||   :.|.     |::...|..|
Yeast   131 NSSSGRSTSNQDMDTSGNAIFLS--KRSLSSPVFNKIIRRKTH---SSHRKILELPENGVTGTPF 190

  Fly    68 NGHVDYLATR------------AYLH--GSSSSIEVLIEPGTSSYRFACQLPITCPSSFEG-TLG 117
            .|..:...:|            :|.:  ||.||...|::.|.....|...||.....:.|| ..|
Yeast   191 EGLRENARSRSSSSNTLNNNSHSYSNRDGSGSSYLFLMKRGNYELPFNTMLPPEVCETIEGLQSG 255

  Fly   118 RIRY----LVNVRFVRPWKFDLNFN-------------------------RCFTVIKVM-DLNSE 152
            .|.|    :::.|  :.|..||:.:                         :.|..:::: .|:.:
Yeast   256 SILYSFEAIIDGR--QLWDTDLSVHTSPHGPIGSTSTSGNGMRTKNKIIIKKFKYLRILRTLSMD 318

  Fly   153 SLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMV-SNDSGVAVEDITVKL 216
            :|.::  .::....|:      ...|....|:|......|...||::.: ..:..:.::  .:::
Yeast   319 NLAMQ--EEISVGNTW------RDKLQYETSIPSRAVPIGSTTPVKIKIFPFEKNIRLD--RIEM 373

  Fly   217 TMVVIYYSQPPSADTNKDRFEMV----LKTGGGVSTKCRQQFTFDLKVPPTPP--------TCFN 269
            .::..|..:..||....|...::    |...|.::.|      .|:..|.|.|        .|..
Yeast   374 ALIQYYAMKDSSAQIYDDEIAVMKITHLADFGPLTDK------LDVDCPFTIPDNLKQITQDCCL 432

  Fly   270 LCSIIQIGYQVEAEARVKGCHGGQ----------------SLHMPITIGSVPLTKQLQKEPRTWG 318
            ..::|::.::::....::....|:                |.|:|:....|...|...|.....|
Yeast   433 QDNLIRVMHKLQVRILLQRQVDGEYKNLEIKAQLPMLLFISPHLPMKGRLVLFDKHDGKIHFRPG 497

  Fly   319 EVLP------PQQLDAKALILIGSEQNGEA---LGSPNPWAADPSIAPPSYAEA--KHISP 368
            |::|      |.|     .:..|.|.|...   |..|.|        ||:|.|:  .|:.|
Yeast   498 ELVPLFLTTYPAQ-----GLTPGVELNSTTTAHLALPQP--------PPNYHESTNDHLMP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 36/191 (19%)
Arrestin_C 174..306 CDD:214976 24/160 (15%)
ART5NP_011582.1 Arrestin_C 332..475 CDD:397050 21/156 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.