DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ROG3

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_116677.3 Gene:ROG3 / 850578 SGDID:S000001918 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:79/484 - (16%)
Similarity:134/484 - (27%) Gaps:183/484 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGES-------------FNGHVD 72
            |:||.:|:...:...:|::.|.:.|..:.. ...|...|..|:..|             :|...|
Yeast    41 LLSGCIVLSINEPMQIKSISLRLYGKIQID-VPLERPQDASSSSLSSSPPKIRKYNKVFYNYAWD 104

  Fly    73 YLATRAYLH---------GSSSSIEVL-------------------------IEPGTSSYRFACQ 103
            .:..:.||.         |||||..:|                         ::.|...:.|:..
Yeast   105 NVNLKEYLSGLRGQSGLAGSSSSSNILGTRQRAQSTSSLKSLKGSSSPSSCTLDKGNYDFPFSAI 169

  Fly   104 LPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVIKVMDL-----NSESLMLR------ 157
            ||.:.|.|.|                      :...||....:..:     |...|:.|      
Yeast   170 LPGSLPESVE----------------------SLPNCFVTYSMESVIERSKNYSDLICRKNIRVL 212

  Fly   158 ---VPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEV-MVSNDSGVAVEDITVKLTM 218
               .|:.||...|.|........:...:|||......|...|:.: :|....|:.:..|.|.|..
Yeast   213 RTISPAAVELSETVCVDNSWPDKVDYSISVPNKAVAIGSATPINISIVPLSKGLKLGSIKVVLFE 277

  Fly   219 VVIYYSQ-PPSADTNKDRFEMVLK----------TGGGV-----------STKCRQQFTFDLKVP 261
            ...|... ||....|:...|:.|:          .|.|.           |.:.:.:....|::|
Yeast   278 NYQYCDPFPPVISENRQVTELNLEDPLNESSGEFNGNGCFVNNPFFQPDHSFQDKWEIDTILQIP 342

  Fly   262 PTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQL 326
            .:...|...|.:         .:.:|..|                                    
Yeast   343 NSLSNCVQDCDV---------RSNIKVRH------------------------------------ 362

  Fly   327 DAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPHKFSKSKKKSQKRGVKGSQER 391
            ..|..|::                               |:||.||.........:..:......
Yeast   363 KLKFFIIL-------------------------------INPDGHKSELRASLPIQLFISPFVAL 396

  Fly   392 KAETIVFSPLYAVFDLSNQVDEMTLRANE 420
            ..:.:..|.||::|..:||.||.:.:..|
Yeast   397 SIKPLSSSNLYSLFSTTNQKDENSSQEEE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 30/180 (17%)
Arrestin_C 174..306 CDD:214976 25/154 (16%)
ROG3NP_116677.3 Arrestin_N <156..215 CDD:419887 12/80 (15%)
Arrestin_C 232..393 CDD:214976 32/236 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.