DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and LOC799768

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_009300042.3 Gene:LOC799768 / 799768 -ID:- Length:377 Species:Danio rerio


Alignment Length:380 Identity:82/380 - (21%)
Similarity:155/380 - (40%) Gaps:63/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGES-FNGHVDYL 74
            |....|.:|.::.|:|:::..|..:|.::.:...|.|:.:|.:          ||| ::.|..|.
Zfish    39 NESNTFNSGDIVEGRVLLEVTKNLTVDSLFVKFTGGAKVYWTE----------GESKYHDHERYF 93

  Fly    75 ATRAYL-HGSSSSIEVLIEPGTSSYRFACQLP-ITCPSSFEGTLGR----IRYLVNVRFVRPWKF 133
            ..:..| .|.|.....:|.||.....|..||| ...|.||:..:..    |||.:..:..||:|.
Zfish    94 KLKQDLTPGRSGKERQIISPGRHVLPFKFQLPEQNLPPSFKEKVSGFNCWIRYALTAKLKRPFKS 158

  Fly   134 DLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVE 198
            ........|.:....:.::.|:.......:.:.||     .|..:|:..:..::|::.|:.:.|.
Zfish   159 ASTAYAELTFVPRSHVTNDHLLKPQNRTDKMKNTF-----SSGKISLTATTDKTGYMLGETIKVC 218

  Fly   199 VMVSNDSGVAVEDITVKLTM----VVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFDLK 259
            |.:.|.|.   .|..:|.::    :.|      ::.|.|....::.:|...:.:..:::|..::|
Zfish   219 VDIDNASS---RDAKLKYSLKQQQMFI------ASRTTKRSKHIIQETSDCIPSGEKRRFLVNIK 274

  Fly   260 VPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGE----V 320
            :|......|..|.||::.|.::....|... ...::..|:.|  :|   .||:.| .|.:    .
Zfish   275 LPRDIMVSFENCRIIRVLYLLKVSLDVSFA-SDPAVKFPVVI--IP---PLQQCP-PWQDPPPPY 332

  Fly   321 LPPQQLDAKALILIGSEQNGEALGSPNPWAA--DPSIAPPSYAEAKHISPDPHKF 373
            :|||.:....             |:|.|:|.  ||  .||:...|..:...|..|
Zfish   333 MPPQPVPHPG-------------GAPPPFARLYDP--VPPNPGAAAGLPGSPFGF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 35/145 (24%)
Arrestin_C 174..306 CDD:214976 25/135 (19%)
LOC799768XP_009300042.3 Arrestin_N 39..158 CDD:328947 33/128 (26%)
Arrestin_C 194..319 CDD:308405 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.