DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrdc2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_012821263.1 Gene:arrdc2 / 780156 XenbaseID:XB-GENE-946088 Length:418 Species:Xenopus tropicalis


Alignment Length:441 Identity:102/441 - (23%)
Similarity:177/441 - (40%) Gaps:99/441 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNG-----ESFNGHVDYL 74
            ::.||:::.|:||::..||..|.|:.:..:|.|..||.::      :|.|     ..|..:..||
 Frog    38 VYSAGEIVEGKVVLELCKELRVSALEVCGRGLATVHWLES------RSVGMNTVYSDFTSYETYL 96

  Fly    75 ATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNR 139
            ..|.:|...:.:: .::..|...:.|:.|||.|..:||||..|.:||.|..:..|||.......:
 Frog    97 RKRQHLIRDNGTL-TMLPAGRHEFPFSFQLPETLVTSFEGKHGSVRYWVKAKLHRPWCTVKKVKK 160

  Fly   140 CFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSND 204
            .||||:.:|:|:..|:  .|.....::....:.|....:|:...:.:.|:.||:::|:...:.|.
 Frog   161 EFTVIEPIDIN
TPDLL--APQAGSKEKIAHAWYCNLGHVSVTAKIDRKGYTPGEVIPIFAEIDNC 223

  Fly   205 SGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD---LKVPPTPPT 266
            :..||      :....|..||...|.....:.:.|:.|..|.:....::.|:.   ||:||..|:
 Frog   224 TTRAV------IPKAAIIQSQAFVARGTMKQKKSVVATLAGDAVPAGKRETWHGRALKIPPLGPS 282

  Fly   267 CFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL------TKQLQKEPRT---WGEVLP 322
            ... |.||::.|.::....:.| .....|.:|:.||::||      |..:..:...   |..:..
 Frog   283 ILQ-CRIIRVEYTLKVCVEIPG-SSNLVLELPLVIGTIPLHPFGSRTSSVGSQYSVNLEWLRMTV 345

  Fly   323 PQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYA------EAKHISPDPHKFSKSKKKSQ 381
            |:|                    |.|        ||.|:      ||:|....||..|..     
 Frog   346 PEQ--------------------PEP--------PPDYSSVVSEEEAEHNLSPPHHSSMG----- 377

  Fly   382 KRGVKGSQERKAETIVFSPLYAVFD--------LSNQVDEMTLRANEPKTD 424
                         .::..|.||...        |.::||     .|.|..|
 Frog   378 -------------CLLEGPFYAYIQEFRNRPPPLYSEVD-----PNPPTAD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 42/139 (30%)
Arrestin_C 174..306 CDD:214976 30/134 (22%)
arrdc2XP_012821263.1 Arrestin_N 36..171 CDD:334019 42/139 (30%)
Arrestin_C 195..320 CDD:214976 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8042
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4245
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm9421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.