DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_081836.1 Gene:Arrdc2 / 70807 MGIID:1918057 Length:407 Species:Mus musculus


Alignment Length:376 Identity:84/376 - (22%)
Similarity:159/376 - (42%) Gaps:54/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLAT 76
            ::.:|:.||.::|:|:::......|.|:.|..:|.|..||.::.......:..:|::..|:.:..
Mouse    20 TEPVFHGGQAVAGRVLLELAGAARVGALRLRARGRARAHWTESRSAGSSTAYTQSYSERVEVVNH 84

  Fly    77 RAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCF 141
            ||.|....|.....:..|...:.|:.||||:..:||||..|.:||.:.....|||.......:.|
Mouse    85 RATLLAPDSGDIATLPAGRHEFPFSFQLPISLVTSFEGKHGSVRYSIKATLHRPWVPARCARKVF 149

  Fly   142 TVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSNDSG 206
            |||:.:|:|:.:|:  .|.....::....:.|....:|:...:.:.|:.||:::|:...:.|.|.
Mouse   150 TVIEPVDIN
TPALL--EPQAGAREKVARSWYCTRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGST 212

  Fly   207 VAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD---LKVPPTPPTCF 268
            .||:      ....:..:|...|...:.:...|:.:..|......::..:.   |::||..|:..
Mouse   213 RAVQ------PRAALVQTQTFMARGARKQKRAVVASVDGEPVGPNRRALWPGRALRIPPVGPSIL 271

  Fly   269 NLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQLDAKALIL 333
            . |.::.:.|.::....:.| .....|.:|:.||:|||      .|                   
Mouse   272 Q-CRVLSVDYSLKVFVDIPG-SSKLLLELPLVIGTVPL------HP------------------- 309

  Fly   334 IGSEQNGEALGSPNPWAADPSI--------APPSYAEAKH------ISPDP 370
            :||  ...::||...:..|..:        |||.|:|...      .||.|
Mouse   310 LGS--RSASVGSRASFLQDWGLCTMMDRPEAPPEYSEVVRESQLVCASPGP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 39/137 (28%)
Arrestin_C 174..306 CDD:214976 25/134 (19%)
Arrdc2NP_081836.1 Arrestin_N 9..158 CDD:278754 39/137 (28%)
Arrestin_C 180..307 CDD:214976 25/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7292
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.