DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc5

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001102878.1 Gene:Arrdc5 / 680452 RGDID:1591748 Length:325 Species:Rattus norvegicus


Alignment Length:315 Identity:70/315 - (22%)
Similarity:130/315 - (41%) Gaps:35/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VICEIEFCNNSQGIFYAGQLISGQVVI---KTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSN 63
            |:..||.......::.||..|.||||:   .|..:..||..::. :||.|  |.:...:..|.|.
  Rat     3 VVKSIEVVLPQDAVYLAGSNIDGQVVLTLNSTLVDPVVKVELVG-RGYVE--WNEEIGETRDYSR 64

  Fly    64 GESFNGHVDYL-ATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRF 127
            ....|...||: .|:.:     ...:..:..|:.::.|...||...||:|...:|.|.|.|.. .
  Rat    65 DVICNNKADYVHKTKTF-----PIKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQA-L 123

  Fly   128 VRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPG 192
            ....:..|...|.:.:::.:....:..:...|..||:::......|....:|:.:.:.::.||||
  Rat   124 CMGREHILAKKRLYLLVQGISEFRQRNLSENPLSVEAEKKVSYNCCSRGWVSLHVQMSKNTFVPG 188

  Fly   193 QIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNK--DRFEMVLKTGGGVSTKCRQQFT 255
            :.|.....:.|.:|..::.:...|...|.|....|||:..:  |..|::           ||.  
  Rat   189 EKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFTPSAERRRRADSSELL-----------RQM-- 240

  Fly   256 FDLKVP----PTPPTCFNLCSIIQI--GYQVEAEARVKGCHGGQSLHMPITIGSV 304
            .:.::|    .|..:.|||..::.:  |.| |.|..........::|:|.::.:|
  Rat   241 ANARIPAFNSTTVVSAFNLPLVLSVSSGSQ-ENEIMRTSYELVVTIHLPWSLSTV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 35/149 (23%)
Arrestin_C 174..306 CDD:214976 30/139 (22%)
Arrdc5NP_001102878.1 Arrestin_N 13..124 CDD:419887 31/119 (26%)
Arrestin_C 170..304 CDD:397050 30/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.