DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc4

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001036057.1 Gene:Arrdc4 / 66412 MGIID:1913662 Length:415 Species:Mus musculus


Alignment Length:376 Identity:85/376 - (22%)
Similarity:159/376 - (42%) Gaps:42/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGE-SFNGHV 71
            |.:.|:|.:.:|:.::|.|:::..:..:::.:.|..:|.|.:.|..:.........|. :.:..|
Mouse    21 FEDESKGCYSSGETVAGHVLLEAAEPVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASSEV 85

  Fly    72 DYLATR-AYLHGSSSSIEVLIEPGTSSYRFACQLPI-TCPSSFEGTLGRIRYLVNVRFVRPWKFD 134
            :||..| :.|...:.....|::||...:.|..|||. ...:||.|..|.|:|.|.....||...|
Mouse    86 EYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVLERPQVPD 150

  Fly   135 LNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEV 199
            .:..|...|:..:|:|:..|:  .|.....::...|:...|.|:|:.:.:.:.|:..|:.:|:..
Mouse   151 QSVRRELQVVSHVDVN
TPPLL--TPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNGEAIPIYA 213

  Fly   200 MVSNDSGVAVEDITVKLTMVVIYYSQP--PSADTNKDRFEMVLKTGGGVSTKCRQQFTFD-LKVP 261
            .:.|.|...|      :....|:.:|.  .|..|...|..:....|..:.:.....:... ||:|
Mouse   214 EIENCSSRLV------VPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGKMLKIP 272

  Fly   262 PTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQL 326
            |..|:..: |.||::.|.:.....:.|.. ...|.:|:.||::|.:...::.    ..|.....:
Mouse   273 PVTPSILD-CCIIRVDYSLAVYIHIPGAK-RLMLELPLVIGTIPYSGFGRRN----SSVASQFSM 331

  Fly   327 DAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAE-------AKHISPDP 370
            |...|.|...||              |. |||:||:       ::|:.|.|
Mouse   332 DMCWLALALPEQ--------------PE-APPNYADVVSEEEFSRHVPPYP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 36/144 (25%)
Arrestin_C 174..306 CDD:214976 29/134 (22%)
Arrdc4NP_001036057.1 Arrestin_N 19..166 CDD:306778 36/144 (25%)
Arrestin_C 188..315 CDD:214976 29/134 (22%)
PPxY motif 1. /evidence=ECO:0000305 347..350 2/2 (100%)
PPxY motif 2. /evidence=ECO:0000305 392..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.