DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ARRDC5

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001354118.1 Gene:ARRDC5 / 645432 HGNCID:31407 Length:350 Species:Homo sapiens


Alignment Length:403 Identity:74/403 - (18%)
Similarity:143/403 - (35%) Gaps:93/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VICEIEFCNNSQGIFYAGQLISGQVVI---KTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSN 63
            |:..||.......|:.||..|.|||::   .|..:..||..::. :||.|  |::......|.|.
Human     3 VVKSIELVLPEDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVG-RGYVE--WSEEAGASCDYSR 64

  Fly    64 GESFNGHVDYL-ATRAYLHGSSSSIEVL-----------IEPGTSSYRFACQLPI------TCPS 110
            ....|...||: .|:.:.....:|..|.           ::|.:.:::.:..|.:      ..||
Human    65 NVICNNKADYVHKTKTFPVEEMASRSVTQAGVQWHDLGSLQPPSRTFKLSSHLSLLSTWNYRLPS 129

  Fly   111 SFEGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRS 175
            :|....|.:.|.|....:.. :..|...|.:.:::......:....:.|..||::.......||.
Human   130 TFTSKFGHVFYFVQASCMGR-EHILAKKRMYLLVQGTSTFHKETPFQNPLFVEAEEKVSYNCCRQ 193

  Fly   176 SPLSMRLSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVL 240
            ..:.:::.:.::.|.||:.|.....::|.:...::.:...|...:.|....|||: .:.|.:.  
Human   194 GTVCLQIQMERNTFTPGEKVVFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAE-RRSRLDS-- 255

  Fly   241 KTGGGVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP 305
                  |...||:..       ||.|.||...::                  .:.::|:.:....
Human   256 ------SELLRQEAN-------TPVTRFNTTKVV------------------STFNLPLLLSVSS 289

  Fly   306 LTKQLQKEPRTWGEVLPPQ--------------QLDAKALILIGSEQNGEALGSPNPWAADPSIA 356
            .|:.        ||::..:              .|.||..|:|.|.            :.|.:|.
Human   290 STQD--------GEIMHTRYELVTTVHLPWSLTSLKAKVPIIITSA------------SVDSAIC 334

  Fly   357 PPSYAEAKHISPD 369
            ..|......::||
Human   335 QLSEDGVLPVNPD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 34/166 (20%)
Arrestin_C 174..306 CDD:214976 21/131 (16%)
ARRDC5NP_001354118.1 Arrestin_N 13..146 CDD:328947 30/135 (22%)
Arrestin_C 192..326 CDD:308405 29/175 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.