DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and CG18748

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster


Alignment Length:418 Identity:183/418 - (43%)
Similarity:271/418 - (64%) Gaps:20/418 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VICEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGES 66
            :||:|.|.||:||:|||||:::|||.:.|:|...:||:.|.:||||||||.:::.|.:::|..||
  Fly     3 IICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSES 67

  Fly    67 FNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPW 131
            :||...||:::.||.||..|.|:.:||||.||.|||.:||.||||||||.|||||:|:|..::||
  Fly    68 YNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPW 132

  Fly   132 KFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVP 196
            |:|..|:|.||||:|||:|:.:.:.:||.|.::::||..:|.||.||::.|::||:||||||.||
  Fly   133 KYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVP 197

  Fly   197 VEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFDLKVP 261
            ..|::.|:|.:.|.::.|.|:|::.|||. .|:.:..:|..:......||....|:.:.|.|.:|
  Fly   198 ANVLIGNESKIRVHEVKVGLSMMITYYSD-LSSGSKCERKSVAKLKADGVLRNSRKMYDFQLMIP 261

  Fly   262 PTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLT-KQLQKEPRTWGEVLPPQQ 325
            .|||:||:||.||:||||:|..|:|||.|...:|.||:||..||:: ..:|..|::.|...|.| 
  Fly   262 STPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQ- 325

  Fly   326 LDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPHKFSKSKKKSQKRGVKGSQE 390
               :||.||..|........|.||:...:::||:||||.|          |...|:|:...|:.:
  Fly   326 ---RALTLIEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMH----------SHSDSEKQSESGNAQ 377

  Fly   391 RKAETIVFSPLYAVFDLSNQVDEMTLRA 418
            .|:    :.|||.|||||....|.:..|
  Fly   378 EKS----YKPLYPVFDLSTSTVEKSKEA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 81/145 (56%)
Arrestin_C 174..306 CDD:214976 58/131 (44%)
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 81/145 (56%)
Arrestin_C 175..301 CDD:280848 55/126 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464034
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.