DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and CG18745

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_652648.1 Gene:CG18745 / 59141 FlyBaseID:FBgn0042102 Length:433 Species:Drosophila melanogaster


Alignment Length:455 Identity:192/455 - (42%)
Similarity:281/455 - (61%) Gaps:42/455 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VICEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGES 66
            |.|||:|.||..|.::.|::::|:|.:|.:|.|.|||:.|||.|||||.|.: ....:.:....:
  Fly     3 VTCEIDFDNNPHGTYFGGEVLTGRVTLKLDKMKLVKAITLNITGYAETRWIE-RVTTNRRRRRRT 66

  Fly    67 FNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPW 131
            |.|..||:|::.:|.||:.|.:|.||.|..:|.|.|.:|..|||||||:.||:||:..|..||||
  Fly    67 FCGREDYIASKTFLVGSNLSSQVSIEAGIHTYNFVCLIPTECPSSFEGSHGRVRYMATVTLVRPW 131

  Fly   132 KFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVP 196
            |||.::.|||||:||||||.:|.:||||:..|:.:|:||:||||.||:::|:|||:||||||.||
  Fly   132 KFDQSYTRCFTVLKVMDLNFDSPLLRVPAHSETSKTYCCWPCRSDPLALQLTVPQTGFVPGQNVP 196

  Fly   197 VEVMVSNDSGVAVEDITVKLTMVVIYYSQPPS-ADTNKDRFEMVLKTGGGVSTKCRQQFTFDLKV 260
            :.|:|:|||.:.||.:.:...|:|.|:|:||| .:|..:|..:....|..|...|::.|:::::|
  Fly   197 LSVLVTNDSHIPVEQLLISFVMLVTYHSKPPSMPNTTSERLVVNTFKGDAVQRNCKKLFSYEIRV 261

  Fly   261 PPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQ 325
            |.|||||||||.||||.||||.||||||||..:.:.:|:|||||||.:.:..:||.:   :|  |
  Fly   262 PATPPTCFNLCGIIQIAYQVEVEARVKGCHNNEVVTIPLTIGSVPLAQHVPIQPRGF---VP--Q 321

  Fly   326 LDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPHKFSKSKKKSQKRGVKGSQE 390
            |:...|.:   |:...|..|.:||:.|.||.||:|.||.|:        :|...::...:...:.
  Fly   322 LNVNELAV---EEVATAPNSSSPWSVDASIPPPNYQEAVHM--------RSTAATRSDDLDDPEP 375

  Fly   391 RKAETI-----VFSPLYAVFDLSNQVDEMTLRANEPKTD--------GGYVNEGV----EKSTWL 438
            ....|:     .:.|||.|||:.:.       :..|.||        ..:||..:    :|.|||
  Fly   376 VPPNTLSLDGGAYKPLYPVFDIPSP-------SAPPPTDYTQNYMAERAFVNPAMDVDKDKGTWL 433

  Fly   439  438
              Fly   434  433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 70/145 (48%)
Arrestin_C 174..306 CDD:214976 69/132 (52%)
CG18745NP_652648.1 Arrestin_N 5..150 CDD:278754 70/145 (48%)
Arrestin_C 174..304 CDD:280848 66/129 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464036
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.