DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and si:dkey-172m14.1

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001188367.2 Gene:si:dkey-172m14.1 / 567451 ZFINID:ZDB-GENE-060526-221 Length:399 Species:Danio rerio


Alignment Length:402 Identity:90/402 - (22%)
Similarity:163/402 - (40%) Gaps:89/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLA 75
            |....|..|.::.|:||::..||.:|:.:.:.:.|.|:..|  ||...||:   .|::.|..|..
Zfish    16 NETNTFTNGDIVEGRVVLEVTKEINVENLFVKLTGDADVRW--TEGSGDDE---RSYSDHERYFK 75

  Fly    76 TRAYLHGSSS---------------SIEVLIEPGTSSYRFACQLP-ITCPSSFEGTLGRIRYLVN 124
            .:.|....||               :...:|:||:..:.|..||| ...|.:|:|..|.::|:|.
Zfish    76 QKQYFIQDSSKKGQCEKNTTLVSGETYGSVIKPGSHVFPFRFQLPQQNMPPTFKGFHGWVKYIVM 140

  Fly   125 VRFVRPWK------FDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLS 183
            |:..|.||      .::||     ..:....|...|..:..::.:..:.|     .|..:||.::
Zfish   141 VKLKRSWKPTSSAQAEINF-----APRNFGTNDHLLQPQSGTEDKKMKLF-----GSGKMSMTVT 195

  Fly   184 VPQSGFVPGQIVPVEVMVSNDSGVAVEDITVK--LTMVVIYYSQPPSADTNKDRFEMVLKTGGGV 246
            ..::|::.|:|:.|.|.:.|.|.   .||.:|  |..:..:.:...:...:||   :|.:|...:
Zfish   196 TDKTGYMLGEIIRVSVDIDNSSS---RDIKLKYSLKQLQTFIAGRSTTHAHKD---IVKETKDCI 254

  Fly   247 STKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTK--- 308
            .:..:.:|..|:|:|.........|.||::.|:::             :::.::..|.|..|   
Zfish   255 PSGGKTRFVVDIKLPHDIMVTIENCRIIKVQYELK-------------VYLDVSFASDPTVKFPV 306

  Fly   309 ----QLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIA----------PPS 359
                .||:.| .|.:..||.......|:             |.|..|.|..|          ||.
Zfish   307 VIIPPLQQCP-PWHDPPPPYMPPQPNLV-------------PYPGGAAPPPAGLYPNLYDPVPPY 357

  Fly   360 YAEAKHISPDPH 371
            ...|....|:|:
Zfish   358 PGTAAGTFPNPN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 41/160 (26%)
Arrestin_C 174..306 CDD:214976 27/133 (20%)
si:dkey-172m14.1NP_001188367.2 Arrestin_N 24..149 CDD:304627 36/129 (28%)
Arrestin_C 187..308 CDD:280848 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.