DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrdc3a

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001073498.1 Gene:arrdc3a / 566685 ZFINID:ZDB-GENE-030131-2913 Length:414 Species:Danio rerio


Alignment Length:409 Identity:112/409 - (27%)
Similarity:184/409 - (44%) Gaps:51/409 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CNNSQG--IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHV 71
            |.|...  :|.:|..:||:|:|:...|..||::.:|.||:|:..|.::.:.....:..:::...|
Zfish    15 CLNDSNVPVFSSGDSVSGRVIIEVTGEIRVKSLKINAKGFAKVRWTESRNAGSSTAYTQNYTEEV 79

  Fly    72 DYLATRAYLHG----SSSSIEVL--IEPGTSSYRFACQLPIT-CPSSFEGTLGRIRYLVNVRFVR 129
            :||..|..|.|    ..:|.|.|  |..|...|.|:.:||.| ..:||||..|.:||.|.....|
Zfish    80 EYLNHRDILIGHERDDDNSEEGLTTIHSGRHEYAFSFELPQTPLATSFEGKHGSVRYWVKAELHR 144

  Fly   130 PWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQI 194
            ||...:...:.|||.:.:|:|:.  :|..|.....::|.||:.|.|.|:|:...:.:.|:.||:.
Zfish   145 PWLLPMKTKKEFTVFEHIDINTP--LLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGES 207

  Fly   195 VPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD-- 257
            :.:...:.|.|...|      :....||.:|...|.......:.::....|.|....:..|::  
Zfish   208 IQIFAEIENCSSRMV------VPKAAIYQTQTFFAKGKMKEIKQLVANIRGESLSSGKTETWNGK 266

  Fly   258 -LKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL------TKQLQKE-- 313
             ||:||..|:..: ||||::.|.:.....:.|.. ..||::|:.||::||      |..:..:  
Zfish   267 MLKIPPVSPSILD-CSIIRVEYSLMVYVDIPGAM-NLSLNLPLVIGTIPLHPFGSRTSSVSSQCS 329

  Fly   314 -PRTW-GEVLP--PQQLDAKALILIGSEQNGEALG-SPNPWAAD-PSIA---------PPSYAEA 363
             ..:| |..||  |:...|.|.: :..||....|. ||.....| |..|         ||.|:|.
Zfish   330 MTMSWLGMALPERPEAPPAYAEV-VTEEQRQNCLEVSPGRENYDGPLFAYIQEFRFRPPPPYSEI 393

  Fly   364 KHISPDPHKFSKSKKKSQK 382
                 |||....:....|:
Zfish   394 -----DPHPDQATSTAEQR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 47/149 (32%)
Arrestin_C 174..306 CDD:214976 32/134 (24%)
arrdc3aNP_001073498.1 Arrestin_N 22..165 CDD:278754 45/142 (32%)
Arrestin_C 188..311 CDD:280848 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.