DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Txnip

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:380 Identity:81/380 - (21%)
Similarity:145/380 - (38%) Gaps:58/380 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNG 69
            |:.| |:.:.::.:|:.::|:|:::..:...||||.:...|.|:..|         ....:....
Mouse    11 EVVF-NDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLW---------MQGSQQCKQ 65

  Fly    70 HVDYLATRAYL-----HGSSSSIEVLIEPGTS-SYRFACQLPI-TCPSSFEGTLGRIRYLVNVRF 127
            .:|||.....|     ..:..:..|::.||.. .|:|..:||. ...:||:|..|.:.|.|....
Mouse    66 TLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFL 130

  Fly   128 VRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPG 192
            .||.:......:.|.|:.::|:|:..||  .|...:.::...|.......:|:...:.:.||..|
Mouse   131 DRPSQPTQEAKKNFEVMDLVDVN
TPDLM--APVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEG 193

  Fly   193 QIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGG---VSTKCRQQF 254
            ..:.:.....|    ....|.|....:|..::...:..|..  |...|.:..|   :|..|....
Mouse   194 DDISIHADFEN----TCSRIVVPKAAIVARHTYLANGQTKV--FTQKLSSVRGNHIISGTCASWR 252

  Fly   255 TFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP--LTKQLQKEPRTW 317
            ...|:|....|:... |:|:::.|.:.....|.|.. ...|.:|:.|||..  .::......|| 
Mouse   253 GKSLRVQKIRPSILG-CNILKVEYSLLIYVSVPGSK-KVILDLPLVIGSRSGLSSRTSSMASRT- 314

  Fly   318 GEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPHK 372
                             .||.:...|..|     |...|||.|.:   |.|:.|:
Mouse   315 -----------------SSEMSWIDLNIP-----DTPEAPPCYMD---IIPEDHR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 35/151 (23%)
Arrestin_C 174..306 CDD:214976 27/136 (20%)
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:304627 35/151 (23%)
Arrestin_C 175..299 CDD:280848 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.