DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and zgc:110353

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001017785.1 Gene:zgc:110353 / 550482 ZFINID:ZDB-GENE-050417-310 Length:319 Species:Danio rerio


Alignment Length:279 Identity:63/279 - (22%)
Similarity:122/279 - (43%) Gaps:27/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVD--- 72
            |.:..|..|..::|:|:::..|:..:.::.:..||.|...|.:|        :||....:.|   
Zfish    14 NDRNTFSNGDTLAGRVIVEVSKQTKITSLTVQAKGKANVAWTET--------HGEESVTYWDKEK 70

  Fly    73 -YLATRAYLHGSSSSIEVLIEPGTSSYRFACQLP-ITCPSSFEGTLGRIRYLVNVRFVRPWKFDL 135
             :..|::.|....:...|.:..|...:.||.||| .:.||||:|..|:|.|.:..:..|.::...
Zfish    71 YFSQTQSVLPEDKADGSVTLVAGRHVFPFAFQLPNQSLPSSFKGVHGKIHYRLMAKLSRSFRAAS 135

  Fly   136 NFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVM 200
            .....||.:...|.::.:  |..|......:....|  .|..:||.:.:|::|:..|     |.:
Zfish   136 KAEAKFTFVARADY
DTST--LTTPQHGSKDKNVMFF--ASGNISMDIFLPKTGYQQG-----EGL 191

  Fly   201 VSNDSGVAVEDITVKLT-MVVIYYSQPPSADTNK--DRFEMVLKTGGGVSTKCRQQFTFDLKVPP 262
            :.|  |..|...|.|:. ..:||..|...|...:  ...|::.:.|..:.:..|:.....|.:||
Zfish   192 IVN--GEIVNSSTRKIVPKYIIYQKQSFFAGGQRAVHTTEILKEKGEPLVSSTRENLYKVLPLPP 254

  Fly   263 TPPTCFNLCSIIQIGYQVE 281
            ...:..:.|.|:::.|:::
Zfish   255 EISSTIHNCRILKVEYRLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 35/143 (24%)
Arrestin_C 174..306 CDD:214976 25/111 (23%)
zgc:110353NP_001017785.1 Arrestin_N 6..149 CDD:304627 34/142 (24%)
Arrestin_C 171..293 CDD:280848 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579492
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.