DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and txnipb

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001239433.1 Gene:txnipb / 448858 ZFINID:ZDB-GENE-040917-1 Length:378 Species:Danio rerio


Alignment Length:406 Identity:83/406 - (20%)
Similarity:158/406 - (38%) Gaps:83/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTE-HDPDDQSNGESFN 68
            |::..:.::..:..|..::|:|:::..:...|.||.|...|.|:.::...: |..::        
Zfish    12 EVQMSDPNKIAYSGGDKVAGRVIVEVAELLKVSAVKLFGVGCAKVNYKKGKLHCSEE-------- 68

  Fly    69 GHVDYLATRAYLHGSSSSI-----EVLIEPGTS-SYRFACQLPIT-C-PSSFEGTLGRIRYLVNV 125
              ::||.....||....|.     .:.:.||.. .:.|..:||.: | .||:||..|.::|.|..
Zfish    69 --IEYLKYEEILHLDHHSTTDDEGSITLRPGNRYEFMFGFELPQSGCLVSSYEGKFGSVQYYVRA 131

  Fly   126 RFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFV 190
            ...:..:......|.|.|::.:|:|::.||  .|.:...|:...|.......:|:..|:.:.|:.
Zfish   132 VMEKSSQTFAECKRYFEVVEPIDVN
TQELM--APVKGSKQKKVTCMFIPDGSVSIVASIGRKGYC 194

  Fly   191 PGQIVPVEVMVSNDSGVAVEDITVKLTMVV---IYYSQPPSADTNKDRFEMVLK--------TGG 244
            .|:.:.::....|.|    ..|.:....::   ||.     |:.....||..|.        :|.
Zfish   195 EGEDICIDAQFENTS----SRIVIPKAAIIAKHIYL-----ANGRTKVFEEKLTSVRGNHIISGM 250

  Fly   245 GVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP---- 305
            |...:.|.     |:||...||... |.||.:.|.:.....:.|.. ...|.:|:.||::|    
Zfish   251 GDIWQGRV-----LRVPKLKPTILG-CDIIHVDYSLRIYLHIPGSE-KLILELPLVIGTIPYNGM 308

  Fly   306 ------LTKQ---------LQKEPRTWGEVLPPQQLDAKALILIGSEQNGEA-----LGSPNPWA 350
                  ::.|         |...|.::..:  ..::|:..:.|:......::     :..|.|  
Zfish   309 NSRTSSMSSQESASSTCVSLPSSPPSYSNI--SNRMDSSFIPLLDDYDEDDSPIFMQIHHPLP-- 369

  Fly   351 ADPSIAPPSYAEAKHI 366
                 .||.|.|  ||
Zfish   370 -----PPPLYTE--HI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 33/153 (22%)
Arrestin_C 174..306 CDD:214976 31/152 (20%)
txnipbNP_001239433.1 Arrestin_N 11..156 CDD:304627 33/153 (22%)
Arrestin_C 179..305 CDD:214976 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.