DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and CG2993

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001262348.1 Gene:CG2993 / 40924 FlyBaseID:FBgn0037521 Length:545 Species:Drosophila melanogaster


Alignment Length:529 Identity:128/529 - (24%)
Similarity:213/529 - (40%) Gaps:114/529 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFN 68
            |.|.|.||.||::||||.:||.|.:..:..|.:|.:.:.:.|||:..|....:..|  |......
  Fly     5 CLISFDNNPQGVYYAGQELSGVVDLSVDATKRIKGIHVTVSGYAKIRWIKKGYPRD--SERAMCR 67

  Fly    69 GHVDYLATRAYLHGSSSSIEVLIEP-GTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWK 132
            .:..||::|:|:.||.::...:..| |..||.|...||...|:||:|..|:|.|.:.....|..:
  Fly    68 AYRSYLSSRSYVLGSCANNSSIDWPAGEYSYTFHVILPDNLPTSFDGKYGQIHYEIITTIERAAR 132

  Fly   133 FDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPV 197
            ....|...||||:.:|||:::: .|||.::..::.|..|.|.:.||:::.|.|..|:.|||.:..
  Fly   133 HPKVFKLPFTVIQPLDLNADAI-YRVPLEILDRKRFWSFCCPTGPLTVKFSTPYCGYAPGQKIHF 196

  Fly   198 EVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFDLKVPP 262
            .:.::|:|.:.:.:..|||...|.|.|..|..:...|:..:..|..|.|....|:.:...|.:|.
  Fly   197 VLYINNESSIDIIECEVKLKQEVSYESHDPQHEYRYDKHLIARKQFGNVLRWSRKVYRGYLDLPS 261

  Fly   263 TPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL--------------------- 306
            .|||.......|.:.|.::........|....|.:|:||||:|:                     
  Fly   262 IPPTSVKPTCPISVNYSIKIIVNPTEFHWKLKLKIPLTIGSIPIMDGPEALLRFNRQQQQHQVVS 326

  Fly   307 ------TKQLQKEPRTWGEVLPPQQLD-------------AKALILIGSEQN--GEALG------ 344
                  |:|.|::.....::...::.|             .:.:..|.:..|  |..:|      
  Fly   327 QNLQMSTQQRQRDRDRDRDMNVDRERDRDRDRDRISASVQQRRISSINNNNNNHGRLVGGLLPTN 391

  Fly   345 ---------SPNPWAADPS------------------------------IAPPSYAEAKHISPDP 370
                     ||.|.::.||                              :.||||.:|..:|   
  Fly   392 SNMNMITNVSPTPTSSTPSSTPTTAALRPTAMPAILVTSDSDNPPDYIPMMPPSYEDAMALS--- 453

  Fly   371 HKFSKSKK---KSQKRGVKGSQERKAETIVFSPLYAV--------------FDLSNQVDEMTLRA 418
            .|||...:   ......:..:|.....:..|.|.|.|              :|.|:....:||..
  Fly   454 EKFSDDTEFLTNVSMSSILSAQADVTTSEPFKPRYPVYYDYETPTIPPETLYDESSSRLRLTLSC 518

  Fly   419 NE---PKTD 424
            .:   |:||
  Fly   519 QDSAAPETD 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 49/146 (34%)
Arrestin_C 174..306 CDD:214976 36/131 (27%)
CG2993NP_001262348.1 Arrestin_N 5..150 CDD:304627 49/146 (34%)
Arrestin_C 173..302 CDD:280848 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464072
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.