DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and CG18268

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster


Alignment Length:401 Identity:100/401 - (24%)
Similarity:162/401 - (40%) Gaps:86/401 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVK--AVILNIKGYAETHWADTEHDPDDQSNGES 66
            ||... :.:..|:|.|:.|||.:.:..:.:||.|  .|.:.:.|.:..||.::...|.:..:.:|
  Fly     5 CEFNL-SRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEHNDS 68

  Fly    67 FNG----HVDYLATRAYLHGSSSSIEVL-IEPGTSSYR---FACQLPITCPSSFEGTLGRIRYLV 123
            ...    .|||..::.:::.:....||| :|.||  :|   |..|||...|::.....|.:.|::
  Fly    69 TGNLECPKVDYNGSKVHINETKKLNEVLQLENGT--FRLGDFNFQLPENLPATCRLPFGNVEYVL 131

  Fly   124 NVRFVRPWKFDLNFNRCF-------TVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMR 181
            .|...|..    ..|:||       ..:::.||.        |..:|:             .:|.
  Fly   132 KVVLERRG----THNKCFQQRLVIRKCVELADLK--------PQYMET-------------ANMG 171

  Fly   182 LSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGV 246
            |::|:|.|||||.|..|: .|.|   .|:|...:|...:.|.||.|||.|.  ....||...   
  Fly   172 LTLPRSVFVPGQSVSYEI-CSKD---GVQDFLTRLCKKISYTSQQPSAKTK--NVTQVLSES--- 227

  Fly   247 STKCRQQFTFDLKVPPTPPTCFNLCSI--IQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQ 309
                 .:...:|::|.|.|...:...:  |||.|.:|.         ..||:.||          
  Fly   228 -----SELNGNLRLPLTAPIMSHSDQLDPIQISYYIET---------FNSLNAPI---------- 268

  Fly   310 LQKEPRTWGEVLPP--QQLDAKALILIG-SEQNGEALGSPNPWAADP-SIAPPSYAEAKHISPDP 370
              |.|.....|.||  .|.::..|..:. :....|.||..|.:.|:. |....:.|.:||...:.
  Fly   269 --KVPIFVATVAPPVNSQTESSQLCFVNMALSQSELLGPINQFLANSCSREIDALALSKHCERER 331

  Fly   371 HKFSKSKKKSQ 381
            .|..|..|:.:
  Fly   332 IKLLKGPKRKK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 40/162 (25%)
Arrestin_C 174..306 CDD:214976 38/133 (29%)
CG18268NP_649739.1 Arrestin_N 5..153 CDD:304627 39/154 (25%)
Arrestin_C 172..259 CDD:280848 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.