DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and txnipa

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_956381.1 Gene:txnipa / 368359 ZFINID:ZDB-GENE-030804-10 Length:400 Species:Danio rerio


Alignment Length:379 Identity:81/379 - (21%)
Similarity:148/379 - (39%) Gaps:64/379 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ICEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAV-ILNIKGYAETHWADTEHDPDDQSNGES 66
            :.||.|.:.|:..:.:|..::|:|:::..:...|.|: :|.: |.|:..:|         ...:.
Zfish    10 VFEIAFNDPSKTFYCSGDKVAGKVLVEVSEVTRVMAMKVLGV-GCAKVEYA---------KGKQR 64

  Fly    67 FNGHVDYLATRAYL----HGSSSSIEVLIEPGTS-SYRFACQLPI--TCPSSFEGTLGRIRYLVN 124
            ....||||.....:    |.:.:...|::.||.. .|.|..:||.  ...||::|..|.::|.|.
Zfish    65 CREEVDYLKYEDVVQLDEHPTDNDGSVILRPGNKYEYSFGFELPAQGQLVSSYKGKFGFVQYYVK 129

  Fly   125 VRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGF 189
            ....||.:..|...:.|.|.:.:|:|:..|:  .|:....::...|.......:|:...:.:.||
Zfish   130 ALMERPCQPALECKKHFEVEEPLDVNTPDLL--SPTGGMKEKKVTCMFIPDGQVSLNAKIDRRGF 192

  Fly   190 VPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGG---VSTKCR 251
            ..|:.:.::....|...      .:.:....|...|...|:.....|...|.:..|   :|..|.
Zfish   193 CEGEEICIDAKFENTCS------RIVVPKAAIVAKQTYQANGRTKVFRQKLSSVRGNHIISGMCD 251

  Fly   252 QQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL------TKQL 310
            ......::||...|:... |:||::.|.:.....:.|.. ...|.:|:.||:||.      |..:
Zfish   252 AWQGKSIRVPKIKPSILG-CNIIRVEYALMIYMHIPGSE-KLILELPLVIGTVPYNGFGSRTNSM 314

  Fly   311 QKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAA--DPSIAPPSYAE 362
                                     |.|:|....:.|.|.:  .||.|||||.:
Zfish   315 -------------------------SSQDGSISNASNSWVSLRMPSSAPPSYCD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 37/153 (24%)
Arrestin_C 174..306 CDD:214976 26/134 (19%)
txnipaNP_956381.1 Arrestin_N 11..155 CDD:304627 37/153 (24%)
Arrestin_C 178..304 CDD:214976 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.