DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc1

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_038961502.1 Gene:Arrdc1 / 366001 RGDID:1309961 Length:466 Species:Rattus norvegicus


Alignment Length:402 Identity:78/402 - (19%)
Similarity:157/402 - (39%) Gaps:83/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQG--IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYL 74
            |||  ::..|:.::|.|.::.......:|:.:...|....         .:::|..:      ::
  Rat    12 SQGRVVYSPGEPLAGAVHLRLGAPLPFRAIRVTCMGSCGV---------SNKANDGA------WV 61

  Fly    75 ATRAYLHGSSSSIEV-LIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNV-----RFVRPWKF 133
            ...:|.:.|.|..:. .:.||..::.|...||.|.|:||||..|:|.:.|..     ||.:..|.
  Rat    62 VEESYFNSSLSLADKGSLPPGEHNFPFQFLLPATAPTSFEGPFGKIVHQVRASIDTPRFSKDHKC 126

  Fly   134 DLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVE 198
            .|    .|.::..::|||.. .:..|:...:.:.|.....::..:.:..|....|:|.||::.::
  Rat   127 SL----VFYILSPLNLN
SIP-DIEQPNVASTTKKFSYKLVKTGSVVLTASTDLRGYVVGQVLRLQ 186

  Fly   199 VMVSNDSGVAVEDITVKLTMV-VIYYSQP-----------PSADTNKDRFEMVLK---------- 241
            ..:.|.||.....:...|..| .|::.:|           ..|.|:...|...:.          
  Rat   187 ADIENQSGKDTSPVVASLLQVRAIWFPEPVPFPWDRRGGCQPAQTHSPVFPQKVSYKAKRWIYDV 251

  Fly   242 ------TGGGVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPIT 300
                  .|.||......|:...:.||..|.:....||:|.|.|.::...:....    ::.:|:.
  Rat   252 RTIAEVEGTGVKAWRHAQWQEQILVPALPQSALPGCSLIHIDYYLQVSMKAPEA----TVTLPLF 312

  Fly   301 IGSVPLTKQ-------LQKEPRTWGEVLP--PQQLDAKALILIGSEQNGEALGSPNPWAADP-SI 355
            :|::.:.:.       ....|.....|:|  |.|.:|:|:             :..|..:|| |:
  Rat   313 VGNIAVNQTPLSPCPGPGSSPGLLSPVVPSAPPQEEAEAV-------------ASGPHFSDPVSL 364

  Fly   356 APPSYAEAKHIS 367
            :..|:::.:.:|
  Rat   365 STKSHSQQQPLS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 31/145 (21%)
Arrestin_C 174..306 CDD:214976 29/159 (18%)
Arrdc1XP_038961502.1 Arrestin_N 7..139 CDD:419887 31/145 (21%)
Arrestin_C 162..316 CDD:214976 29/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.