DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001100773.2 Gene:Arrdc2 / 306344 RGDID:1309659 Length:407 Species:Rattus norvegicus


Alignment Length:381 Identity:88/381 - (23%)
Similarity:157/381 - (41%) Gaps:74/381 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLAT 76
            ::.:|:.||.::|:|:::......|.|:.|..:|.|..||.::.......:..:|::..|:.:..
  Rat    20 TEPVFHGGQAVAGRVLLELAGAARVGALRLRARGRARAHWTESRSAGSSTAYTQSYSERVEVVNH 84

  Fly    77 RAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCF 141
            ||.|....|...|::..|...:.|:.||||:..:||||..|.:||.:.....|||.......:.|
  Rat    85 RATLLAPDSGDIVMLPAGRHEFPFSFQLPISLVTSFEGKHGSVRYSIKATLHRPWVPARRARKVF 149

  Fly   142 TVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSNDSG 206
            |||:.:|:|:.:|:  .|.....::....:.|....:|:...:.:.|:.||:::|:...:.|.|.
  Rat   150 TVIEPVDINTPALL--EPQAGAREKVARSWYCTRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGST 212

  Fly   207 VAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD-------------- 257
            .||               ||.:|......|    ...|....||....:.|              
  Rat   213 RAV---------------QPRAALVQTQTF----MARGARKQKCAVVASVDGEPVGPGRRALWPG 258

  Fly   258 --LKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEV 320
              |::||..|:..: |.::.:.|.::....:.| .....|.:|:.||:|||      .|      
  Rat   259 RALRIPPVGPSILH-CRVLSVDYSLKVCVDIPG-SSKLLLELPLVIGTVPL------HP------ 309

  Fly   321 LPPQQLDAKALILIGSEQNGEALGSPNPWAADPSI--------APPSYAEAKHISP 368
                         :||  ...::||...:..|..:        |||.|:|....||
  Rat   310 -------------LGS--RSASVGSRASFLQDWGLCALMERPEAPPEYSEVVRESP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 40/137 (29%)
Arrestin_C 174..306 CDD:214976 29/147 (20%)
Arrdc2NP_001100773.2 Arrestin_C 180..307 CDD:214976 29/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7129
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8998
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.