DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc4

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001380690.1 Gene:Arrdc4 / 293019 RGDID:1311763 Length:415 Species:Rattus norvegicus


Alignment Length:411 Identity:88/411 - (21%)
Similarity:160/411 - (38%) Gaps:77/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSN------GES 66
            |.:.|:|.:.:|:.::|.|:::..:..:::.:.|..:|.|.:.|.     |...:.      ..:
  Rat    21 FEDESKGCYSSGETVAGHVLLEAAEPVTLRGLRLEAQGRATSAWG-----PSAGARVCIGGASPA 80

  Fly    67 FNGHVDYLATR-AYLHGSSSSIEVLIEPGTSSYRFACQLPI-TCPSSFEGTLGRIRYLVNVRFVR 129
            .:..|:||..| :.|...:.....|::||...:.|..|||. ...:||.|..|.|:|.|.....|
  Rat    81 ASSEVEYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVLER 145

  Fly   130 PWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQI 194
            |...|.:..|...|:..:|:|:..|:  .|.....::...|:...|.|:|:.:.:.:.|:..|:.
  Rat   146 PQVPDQSVRRELQVVSHVDVN
TPPLL--TPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNGEA 208

  Fly   195 VPVEVMVSNDSGVAVEDITVKLTMVVIYYSQP--PSADTNKDRFEMVLKTGGGVSTKCRQQFTFD 257
            :|:...:.|.|...|      :....|:.:|.  .|..|...|..:....|..:.:.....:...
  Rat   209 IPIYAEIENCSSRLV------VPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGK 267

  Fly   258 -LKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP---------------- 305
             ||:||..|:..: |.||::.|.:.....:.|.. ...|.:|:.||::|                
  Rat   268 MLKIPPVTPSILD-CCIIRVDYSLAVYIHIPGAK-KLMLELPLVIGTIPYSGFGRRNSSMASQFS 330

  Fly   306 -----LTKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGS-PNPWAADPSIA-------- 356
                 |...|.::|..     ||...|     ::..|:....:.. |.|.|.|....        
  Rat   331 MDMCWLALALPEQPEA-----PPNYAD-----VVSEEEFSRHIPPYPQPSACDGEACYSMFACIQ 385

  Fly   357 ------PPSYAEAKHISPDPH 371
                  ||.|:|.     |||
  Rat   386 EFRFQPPPLYSEV-----DPH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 36/149 (24%)
Arrestin_C 174..306 CDD:214976 30/155 (19%)
Arrdc4NP_001380690.1 Arrestin_N 19..166 CDD:395268 36/149 (24%)
Arrestin_C 188..315 CDD:214976 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm12328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.