DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ZK938.11

DIOPT Version :10

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:51 Identity:13/51 - (25%)
Similarity:27/51 - (52%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVIKVMDLN 150
            |..|:|.....:::.  |.|:|.:::...||||.:|...:...|.:.:|::
 Worm    39 FEFQIPTGSRLTYKA--GHIKYTMSLEVDRPWKTNLKVKKEVIVARKLDVD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:425619 13/49 (27%)
Arrestin_C 174..306 CDD:214976
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.