DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ARRDC2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_056498.1 Gene:ARRDC2 / 27106 HGNCID:25225 Length:407 Species:Homo sapiens


Alignment Length:397 Identity:90/397 - (22%)
Similarity:164/397 - (41%) Gaps:65/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLATRAY 79
            :|..||.::|:|:::......|.|:.|..:|.|..||.::.......:..:|::..|:.::.||.
Human    23 VFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRSAGSSTAYTQSYSERVEVVSHRAT 87

  Fly    80 LHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVI 144
            |....:.....:.||...:.|:.|||.|..:||||..|.:||.:.....|||.......:.||||
Human    88 LLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWVPARRARKVFTVI 152

  Fly   145 KVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSNDSGVAV 209
            :.:|:|:.:|:  .|.....::....:.|....:|:...:.:.|:.||:::||...:.|.|...|
Human   153 EPVDIN
TPALL--APQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNGSTRPV 215

  Fly   210 EDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD---LKVPPTPPTCFNLC 271
                  |....:..:|...|...:.:...|:.:..|......|:..:.   |::||..|:..: |
Human   216 ------LPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILH-C 273

  Fly   272 SIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL---------------------TKQLQKEPR 315
            .::.:.|.::....:.|. ....|.:|:.||::||                     ...|.:.|.
Human   274 RVLHVDYALKVCVDIPGT-SKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPE 337

  Fly   316 TWGEVLPPQQLDAKALILIGSEQNGEALG-SPNPWAADPSIA----------------PPSYAEA 363
            .     ||:..:..|      :....||| ||.|...||.::                ||.|:|.
Human   338 A-----PPEYSEVVA------DTEEAALGQSPFPLPQDPDMSLEGPFFAYIQEFRYRPPPLYSEE 391

  Fly   364 KHISPDP 370
               .|:|
Human   392 ---DPNP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 39/134 (29%)
Arrestin_C 174..306 CDD:214976 26/134 (19%)
ARRDC2NP_056498.1 Arrestin_N 9..158 CDD:278754 39/134 (29%)
Arrestin_C 181..307 CDD:214976 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7402
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.