DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and SPAC31A2.12

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_592924.1 Gene:SPAC31A2.12 / 2542940 PomBaseID:SPAC31A2.12 Length:596 Species:Schizosaccharomyces pombe


Alignment Length:344 Identity:64/344 - (18%)
Similarity:132/344 - (38%) Gaps:54/344 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLA-TRAYLHGSSS 85
            :||.||:...:..||||:.|.:.|.....|:    :|.....|...:...:|:. .:.::....:
pombe    39 LSGSVVLCLNEAISVKAISLKLVGKCRISWS----EPSPTVRGGQRHNKQEYVVYEKNWIFVPYT 99

  Fly    86 SIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVIKVMDLN 150
            .....:..|...|.|...||.....|.||.  :..|:|       ::...:.:|.....|::...
pombe   100 GANRTLRAGNYEYPFHVMLPGDIAESVEGL--QSCYVV-------YRLKASIDRTGLASKMVKKK 155

  Fly   151 SESLMLRVPSQ-VESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVE-VMVSNDSGVAVEDIT 213
            ...|:..:|:. :|..:|........:.:...:|||...:..|..:|:. |:|.....:.:..|:
pombe   156 HIRLIRALPADAIEYTQTISVDNTWPNKIEYTISVPTKAYAIGSYIPIHFVLVPLLKRLTIGKIS 220

  Fly   214 VKLTMVVI------YYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQF------TFDLKVPPTPPT 266
            :.|...:.      |...|.|.|.        ::|...:.|:..::|      |.:|::|.:...
pombe   221 ITLKEYITLHVAHGYNGLPASKDE--------VRTVRSLQTEELEEFSDHYELTKNLELPSSLVE 277

  Fly   267 CFNLCSI--IQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTWGEVLPPQQLDAK 329
            |...|.:  |:|.::::....::...|    |:.....::|:..           ::|||....:
pombe   278 CLQDCDLDGIKIRHKLKFSVSLRNPDG----HISELRAALPVVL-----------MIPPQLFGDR 327

  Fly   330 ALILIGSEQNGEALGSPNP 348
            |.: ....:|.|:...|.|
pombe   328 AEV-ESLRENFESFNQPLP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 26/128 (20%)
Arrestin_C 174..306 CDD:214976 25/146 (17%)
SPAC31A2.12NP_592924.1 Arrestin_N 38..144 CDD:304627 24/117 (21%)
Arrestin_C 180..321 CDD:214976 26/163 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.