DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and SPAC1F12.05

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_594331.1 Gene:SPAC1F12.05 / 2542260 PomBaseID:SPAC1F12.05 Length:377 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:69/355 - (19%)
Similarity:111/355 - (31%) Gaps:118/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PDDQSNGESFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYL 122
            ||.::..|:|...........|.||:.:.....|.||        ..|.|..|.|.    .:.|:
pombe    80 PDCKAQVEAFEKWEFSKEPTVYTHGTHTWPFTFIIPG--------HFPQTTNSPFI----NVTYI 132

  Fly   123 VNVRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQS 187
            :..|...|.:.|..|.....:.:.:..|::.:..|:            ||..|  |...|.:|..
pombe   133 LKTRVKIPSQPDFVFEYPLNLKRSIVTNADKIAQRL------------FPPTS--LIALLELPPV 183

  Fly   188 GFVPGQIVPVEVMVSNDSGVAVEDITV--KLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKC 250
             ..|...||||..:   :||..|:..|  :||.:.....:...|..|          |....|..
pombe   184 -IHPLSCVPVEFQL---TGVKPENSKVGWRLTKISWRIEEQIKAQIN----------GCSTHTGT 234

  Fly   251 RQQFTFD----------------------LKVP-----PTPPTC---FNLCSIIQIGYQVEAE-- 283
            ::.:.|.                      .::|     .:.|.|   |:....:.|.:|:..|  
pombe   235 KKPYIFKETRLLGNNEHKSGWKEDGDRIIFEIPISTSLLSKPICDVSFDGQFSLYIAHQLILETI 299

  Fly   284 -ARVKGCH----GGQSLHMPITIGSVPLTKQLQKEPR-----TWGEVLPPQQLDAKALILIGSEQ 338
             ..|...|    ..:.|.|.:   ::|||:      |     :|.|..||.              
pombe   300 VVEVMNSHPINSNARILRMKV---NLPLTE------RGGLGVSWDEECPPM-------------- 341

  Fly   339 NGEALGSPNPWAADPSIAPPSYAEAKHISP 368
                ..|..|       :||:|.:....||
pombe   342 ----FNSVGP-------SPPAYEQVARSSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 19/91 (21%)
Arrestin_C 174..306 CDD:214976 31/170 (18%)
SPAC1F12.05NP_594331.1 LDB19 63..231 CDD:193475 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.