DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and SPBC839.02

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_595242.1 Gene:SPBC839.02 / 2541205 PomBaseID:SPBC839.02 Length:530 Species:Schizosaccharomyces pombe


Alignment Length:437 Identity:80/437 - (18%)
Similarity:144/437 - (32%) Gaps:149/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LISGQVVIKTEKEKSVKAVILNIKGYAETHWAD------------------------TEHDPDDQ 61
            ::.|.:.|:..|...:|.:.|:.||.:.|.|.:                        :|...|:.
pombe    98 VLRGSLCIQIYKPVKLKKIQLSFKGKSRTEWPEGIPPKLFDTYEENSIMNHCWVFFHSEQKVDEN 162

  Fly    62 SNGESFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITC--PSSFEGTLGRIRYLVN 124
            |:|..:...:.:.|..|:.   ..|:|... ||...|.|  :|||:|  |.|.:..:||:.|.:.
pombe   163 SHGAVWYKVLPHYADTAHY---PRSMECFY-PGEYVYNF--ELPISCTYPESIQTDMGRVYYFLE 221

  Fly   125 VRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSS------------- 176
                             |::......|.....|:|  :|..|:    ||.:|             
pombe   222 -----------------TLVDRSSTFSGKSTGRIP--IELIRS----PCSTSVATSEPILVSKSW 263

  Fly   177 --PLSMRLSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMV 239
              .|...:.|.:...|.||:|||....:....|....:.:.|.....||.:..|....:      
pombe   264 EDRLHYEVQVGEKCVVMGQVVPVNFKFTLLGEVKFHKLRLFLMERRYYYCRQRSVRRKE------ 322

  Fly   240 LKTGGGVSTKCRQQFTFDLKVPPTPPTCFNLCSII---QIG---YQVEAEARVKGCH--GGQSLH 296
                     |.||...::...|.      |.|.:.   |:.   |::..:.|:.|||  ....:|
pombe   323 ---------KTRQLLLYERSAPK------NQCLLSDWKQVRPDVYELSDQVRIPGCHDMAANIVH 372

  Fly   297 MPITIGSVPLTKQL--------QKEPRTWGE-------------------------------VLP 322
            ...|..::.:|..:        :..|...|.                               ::|
pombe   373 FDTTYPNIKITHTVRTVLRFSCENSPELMGSAKYLEIYIDSPVRLLSCRCSDGSTMLPAYCPIIP 437

  Fly   323 PQQLDAKAL---ILIGSEQ----NGEALGSPNP----WAADPSIAPP 358
            ..:::..::   |:.|..:    :.:.:|:..|    |.|.|..|||
pombe   438 SSEVNFCSIDNRIIAGMNRDLALDSDIIGNSPPSFDSWTAVPYQAPP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 31/154 (20%)
Arrestin_C 174..306 CDD:214976 28/154 (18%)
SPBC839.02NP_595242.1 Arrestin_N 101..227 CDD:304627 31/148 (21%)
Arrestin_C 263..422 CDD:214976 30/179 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.