DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-16

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_499629.2 Gene:arrd-16 / 190071 WormBaseID:WBGene00013043 Length:399 Species:Caenorhabditis elegans


Alignment Length:453 Identity:114/453 - (25%)
Similarity:172/453 - (37%) Gaps:122/453 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYL 74
            :|.:.|:..|..|.|.|.....:...|||:.::.:|.|.|.|..:|  ....|:|.|  ..|.|.
 Worm    10 SNCEQIYEPGGTIEGYVTFDLRESVKVKAIRISAEGLATTKWLLSE--SSKSSHGRS--REVSYS 70

  Fly    75 ATRAYL------------HGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRF 127
            |...||            |..||     :.||...|.|..|:||..|.||||..|.|||.:....
 Worm    71 AKVTYLDEEQMVWKPSEGHSKSS-----VFPGIHVYPFKFQIPIGVPPSFEGDHGNIRYHMKATV 130

  Fly   128 VRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRT-FCCFPCRSSPLSMRLSVPQSGFVP 191
            .||||.:.:..|..|::...|||.|.|.....|..:|::. |..|  |...:::::.:|:.|:||
 Worm   131 ERPWKTNRSVTRYLTILPPKDLN
KEVLASEETSSWKSKKVGFFLF--RYGKVNLQIRIPKKGYVP 193

  Fly   192 GQIVPVEVMVSNDSG---VAVEDITVKLTMVVIY---YSQP-----PSADTNKDRF--------- 236
            |:.:.:|..:.|.|.   :..|...::....:.|   .|.|     .|:.:..||:         
 Worm   194 GETISIETNIDNMSSRPILKTECYLIQQCRFLAYRYGISGPTDGRRASSLSENDRYLSRKRDEIK 258

  Fly   237 ------EMVLKTGGGVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSL 295
                  ||.::.......|.|      ||:|.|.|| |: .::|.:.|.|..:..|| |....::
 Worm   259 IVSVIHEMHIEPRTEHKAKMR------LKIPCTCPT-FD-STLIHVEYFVVVKLHVK-CRMRNTV 314

  Fly   296 --HMPITIGSVPLTKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPP 358
              ..||.|||.||..: ..:|||                                         |
 Worm   315 KAECPIIIGSKPLADE-HVDPRT-----------------------------------------P 337

  Fly   359 SYAEAKHISPDPHKFSKSKKKSQKRGVKGSQERKAETIVFSPLYAVFDLSNQVDEMTLRANEP 421
            :|.|....|...|           |.:....|:.....|:.|.|.    .::.||    |:||
 Worm   338 TYQEVATFSALTH-----------RSMMSVDEKLTPKYVYYPKYG----KSRDDE----ADEP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 48/151 (32%)
Arrestin_C 174..306 CDD:214976 38/159 (24%)
arrd-16NP_499629.2 Arrestin_N 9..153 CDD:334019 48/151 (32%)
Arrestin_C 178..327 CDD:214976 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm14113
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.