DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-8

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496568.1 Gene:arrd-8 / 189457 WormBaseID:WBGene00012467 Length:364 Species:Caenorhabditis elegans


Alignment Length:394 Identity:99/394 - (25%)
Similarity:164/394 - (41%) Gaps:72/394 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNG- 69
            ||| ::...::..||.::|::.|:.....:..|:.:.|.|..||.|...|:......:|..:.. 
 Worm     8 IEF-DHPAAVYSPGQNVAGKLTIRNRNALNALALKICIHGDIETLWRKFENKGRYDRHGRWYRSS 71

  Fly    70 -HVDYLATRAYLHGSS---SSIEVL---IEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRF 127
             |::|.:....|.|.:   ||||..   |..|.:.:.|..|||...|.|||||.|.:||.|:|..
 Worm    72 EHINYTSKINVLEGIAQPWSSIENANNKIPGGVNIFPFLFQLPANLPPSFEGTHGNVRYSVHVEL 136

  Fly   128 VRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPL------SMRLSVPQ 186
            .|||:.::...|.|:||.|:||||      :|..:   .......|:.|.|      .:::|:|:
 Worm   137 DRPWRMNVEAKRVFSVIPVIDLN
S------IPKTI---NPMIVSSCKHSGLFSNKEVKVKISIPK 192

  Fly   187 SGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQP------PSADTNKD-RFEMVLKTGG 244
            ||::||:.:.|..::.|.:...:..|..||...|.|.:|.      |....:|. ..:....|..
 Worm   193 SGYIPGETIQVSALIQNHTKKPIYSIKAKLEQHVHYQAQQENSHLFPEEHCHKHCEHKTAQTTMS 257

  Fly   245 GVSTKCRQQF--TFDLKVPPTPPTCF-----------NLCSIIQIGYQVEAEARVKGCHGGQSLH 296
            .|...|..:|  ...:.||...|...           :.|.|:.||     |.:...|      .
 Worm   258 KVEKSCHVEFCSNSQINVPLVLPNQLVPSFRTGIIEVDYCIIVDIG-----ENKKLRC------E 311

  Fly   297 MPITIGSVPLTKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYA 361
            :|||:|::|:  .:...|..:.....|.:.:..:.|:..|:               .|..||.|.
 Worm   312 LPITVGTIPI--GVFTRPIAYSITEAPPKYENFSQIVEDSQ---------------ASAPPPEYE 359

  Fly   362 EAKH 365
            ..:|
 Worm   360 NEEH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 49/151 (32%)
Arrestin_C 174..306 CDD:214976 35/157 (22%)
arrd-8NP_496568.1 Arrestin_N 6..159 CDD:334019 49/151 (32%)
Arrestin_C 180..320 CDD:214976 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164591
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm4733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.