DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-23

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_508830.3 Gene:arrd-23 / 188239 WormBaseID:WBGene00020323 Length:444 Species:Caenorhabditis elegans


Alignment Length:481 Identity:98/481 - (20%)
Similarity:163/481 - (33%) Gaps:134/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNI--KGYAETHWADTEHDPDDQSNGES 66
            |.:|. :.....:..|..|.|::.:|. .|.|::...|.|  .||.:.                :
 Worm    16 CMLEL-SRKDACYNWGDTIQGKLNLKI-SEGSIEITSLRILFHGYGKI----------------N 62

  Fly    67 FNGHVDYL--ATRAYLHGSSSSIEVLIEPGTSSYRFACQ--LPITCPSSFEGTLGRIRYLVN--- 124
            ..|..|.|  ....|:...|::|...|......|....:  ||...|:|.....|.|:|::.   
 Worm    63 CKGKKDELLQENMTYMKKFSNAISQPIVVSQQEYSIPIEETLPDQLPTSVYSPKGHIQYVIQCTL 127

  Fly   125 -----------VRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPL 178
                       |:.||.          .|||:.:|||..|.....|.....||.|..|.|....:
 Worm   128 EYKTAAGTPSIVKAVRG----------ITVIESLDLNKISKTWFEPKTEFEQRKFGWFACTGGHI 182

  Fly   179 SMRLSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKL--------------------------T 217
            .:.|:..:|.||.|:.:|....:.|.|...:|.::|.|                          .
 Worm   183 RLHLTFERSAFVCGEAIPFIGKIENKSDRRIEKVSVCLMRNTRFGNDVEDDVENATVDHHLIQED 247

  Fly   218 MVVIYYSQ---------------PPSA-----------DTNKDRFEMVLKTGGG----VSTKCRQ 252
            ::.:|..:               .||.           |.||  |::..|:..|    .|.|.||
 Worm   248 LMAMYIEEGCVNKIDKKVHIPCTAPSTPLPILFRSGQLDGNK--FQLRRKSQLGRLSLTSQKSRQ 310

  Fly   253 QFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKEPRTW 317
            ..:          :..|:..|:.|.|....:.|..|. ....|.:|:.||:||....:..     
 Worm   311 SIS----------STSNMQRILAITYAFLIKVRSNGM-DVIDLSVPVVIGTVPYIDHVNS----- 359

  Fly   318 GEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPH--KFSKSKKKS 380
            |:  |...||...:.|...::       |.|...:...:..:.|:.:|::..|.  ....|.|:|
 Worm   360 GD--PSDPLDRPVINLCRQDK-------PIPLLDEKERSLCNKAQLQHVNKYPFFATLPTSSKQS 415

  Fly   381 QKRGVKGSQERKAETIVFSPLYAVFD 406
            :|..|. :|..|.|..:.:.:.:..|
 Worm   416 KKLCVI-AQNIKVENKIMNTIKSAVD 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 34/165 (21%)
Arrestin_C 174..306 CDD:214976 35/187 (19%)
arrd-23NP_508830.3 Arrestin_C 180..353 CDD:214976 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.