DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-12

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001309576.1 Gene:arrd-12 / 187636 WormBaseID:WBGene00011053 Length:186 Species:Caenorhabditis elegans


Alignment Length:169 Identity:52/169 - (30%)
Similarity:80/169 - (47%) Gaps:15/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGES-FNGH-VDYLATR 77
            ::.|||.|||:||..|..:::.:.:.:.:.|.:.|.:...|.:....|.||| ...| |.|.||.
 Worm    14 VYAAGQKISGRVVFSTASQQNPRWIDVQLHGRSHTFFTRQESETKTNSKGESETKTHTVHYTATA 78

  Fly    78 AYL-------HGSSSSIEVLIEPGTSSYRFACQLPIT-CPSSFEGTLGRIRYLVNVRFVRPWKFD 134
            .:|       ..:..:..:|  ||...::|..|||.: .|.||||..|.|||.|.....|.|||:
 Worm    79 KHLDTAVPLWRKTDKAARLL--PGKYEWQFWFQLPCSVLPPSFEGNNGNIRYWVRAEVSRSWKFN 141

  Fly   135 LNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTF--CCF 171
            :.....|.:...:|||:..: .|.|....:.:..  |||
 Worm   142 IVDESSFEIAPFLDLNTMPI-ARTPLDGFAVKNLGCCCF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 45/144 (31%)
Arrestin_C 174..306 CDD:214976
arrd-12NP_001309576.1 Arrestin_N 6..157 CDD:389964 45/144 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.