DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-11

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496883.2 Gene:arrd-11 / 187635 WormBaseID:WBGene00011052 Length:423 Species:Caenorhabditis elegans


Alignment Length:426 Identity:119/426 - (27%)
Similarity:181/426 - (42%) Gaps:65/426 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFYAGQLISGQVVIKTEKEK-SVKAVILNIKGYAETHWAD------TEHDPDDQSNGES--FNGH 70
            :|:.||.|||:||:.|.:|| ..:||.:.|.|.|.|.|.|      .::|.:.:.:.||  ::.:
 Worm    16 VFFPGQPISGRVVLSTTEEKYKARAVNIKILGLAHTSWTDYDSVRRVDNDGNVRYDSESVHYSSN 80

  Fly    71 VDYLATRAYL----HGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPW 131
            |.||.....|    .||:.     :..|...:.|:..||:..|.||||..|.:||.|.....|||
 Worm    81 VHYLDQALLLWACKDGSNE-----LSAGDYVWPFSYTLPLNVPPSFEGKYGYLRYSVTAEVDRPW 140

  Fly   132 KFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVP 196
            :.|....||.||..::|||:..|.|......||:...||| .|...|.:|:::|::|||||:.||
 Worm   141 RLDKAKRRCITVSPLIDLN
AIPLALTPIDDEESENLGCCF-FRKGYLELRVNIPKTGFVPGETVP 204

  Fly   197 VEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKC----------- 250
            :.:.:.|.|.|.|.::..|:.....:.:.........|.....|.:|....||.           
 Worm   205 MNIHILNHSSVPVTEVKAKIIQQCKFIAYRNGTIFRFDGGSDTLMSGSSQQTKYDTKPVITQTQP 269

  Fly   251 -------RQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKG-CHGGQSLHMPITIGSVPLT 307
                   ..:|..:.::|...||......:|.:.|.|:....... |.......|||.||:||:.
 Worm   270 MTVTPGNEHKFVLEFRLPSVTPTICRFSPVITVEYVVQVRVETTSTCGSAAKCEMPILIGTVPIR 334

  Fly   308 KQLQKE-PRTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPH 371
            ..|... |..:...|||...:.       ::.|.......:..|..||..||||.|:.:      
 Worm   335 NYLPPPIPNNYPIGLPPPYANL-------TDVNVPCPSGGSGTAVIPSAPPPSYQESMY------ 386

  Fly   372 KFSKSKKKSQKRGVKGSQERKAET-IVFSPLYAVFD 406
                        ||.|::.|..|. ..|:|.|.||:
 Worm   387 ------------GVGGTELRAEENEKPFAPKYPVFN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 50/147 (34%)
Arrestin_C 174..306 CDD:214976 35/150 (23%)
arrd-11NP_496883.2 Arrestin_N 6..159 CDD:334019 50/147 (34%)
Arrestin_C 182..332 CDD:214976 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46400
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm4733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.