DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-26

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_500160.2 Gene:arrd-26 / 187599 WormBaseID:WBGene00019873 Length:323 Species:Caenorhabditis elegans


Alignment Length:310 Identity:65/310 - (20%)
Similarity:116/310 - (37%) Gaps:35/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHVDYLATRAYL 80
            :..|..|.|.:.:...|:..:..:|:.:.|.|||.|...:.|...:|.....:..:|...|.|  
 Worm    18 YLGGDPIKGIIEMVCSKQVRITGLIVRLTGVAETGWRSRQDDLPYESRHTFMDEQIDLTTTIA-- 80

  Fly    81 HGSSSSIEVLIEPGTSSYRFACQLPITCPSSFE-GTLGRIRYLVNVRFVRPWKFDLNF--NRCFT 142
              ...:.|..:..|..|..|..::|:...||.| ...|.|||:.......|...|...  .:.|.
 Worm    81 --EHCTDEFELHEGKHSVEFEGRIPLDVLSSVERDNHGSIRYMCTALMAIPEDGDTEVVSEKTFK 143

  Fly   143 VIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSN---- 203
            |..:::|::..|..:.....|.:.|.|| ..|...|...:.|.:.|.:||....:.:.|.|    
 Worm   144 VFSLLNL
DAPYLHDKAHVTEEEEITGCC-GRRKGALIATMQVDEIGVMPGMTSKISLTVENKTKK 207

  Fly   204 ---------DSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEM----VLKTGGGVSTKCRQQFT 255
                     :....:..:..:|..|.:..:.|...|.......:    ..||..||..:.::   
 Worm   208 RKKWMRKKDNHECVLLSLCQQLDFVAVNRNDPMMIDRKSITIAVESHGTCKTKAGVGPQTKE--- 269

  Fly   256 FDLKVPPT-PPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSV 304
            .:..|||. |||..:...::.:.|..:.:.      ....|.:|:.:|||
 Worm   270 IEFSVPPNLPPTSIHANRLVTVSYFFKLDL------DHFDLVLPVIVGSV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 31/136 (23%)
Arrestin_C 174..306 CDD:214976 28/149 (19%)
arrd-26NP_500160.2 Arrestin_N 6..150 CDD:389964 31/135 (23%)
Arrestin_C 174..314 CDD:367164 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.