DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-3

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496010.2 Gene:arrd-3 / 187498 WormBaseID:WBGene00006429 Length:287 Species:Caenorhabditis elegans


Alignment Length:304 Identity:61/304 - (20%)
Similarity:126/304 - (41%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPD--DQSNG---------ESFNGHVDY 73
            :.::|.|||...||...:.:.:.||||.:|.|.:.:..|.  .:|||         :|...::.|
 Worm    19 ECVTGNVVIINRKELKARTLRVYIKGYQKTSWKEIQQKPSLVVRSNGVNVKSTIKLKSHGENIQY 83

  Fly    74 LATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFN 138
            :.....|...:|..: .|:|||..:.|:.:||..||.                 :.|       |
 Worm    84 IHLYMTLWNFTSDTD-CIKPGTHKFPFSFKLPADCPP-----------------IVP-------N 123

  Fly   139 RCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSN 203
            ..:....:..:|.          ..|:.....|  :|..:|::.|.||...:.|:::|:.:::.|
 Worm   124 ATYIPKDLQQING----------AVSKNIGVFF--KSGIVSVKTSFPQRVLITGEVIPLTLLIDN 176

  Fly   204 DSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFDLKVPPTPPTCF 268
            .|...|.::.|::..:..:|::.....|.:.:  ::::....|.....||...:.||..|..|..
 Worm   177 KSTCTVREVGVRIFRIARFYAKDQEKMTRQRK--IMIRKSINVEPNTEQQELIEFKVHETVQTFE 239

  Fly   269 NLCSIIQIGYQVEAEA-RVKGCHGGQSLHMPITIGSVP-LTKQL 310
            :  .:|::.|.:..:. ......|..:....:.||:.| :|:::
 Worm   240 S--DLIEVKYLMHVDVFTTSAFRGTLNSVFSVIIGASPTMTEEI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 31/140 (22%)
Arrestin_C 174..306 CDD:214976 26/133 (20%)
arrd-3NP_496010.2 Arrestin_N 4..>119 CDD:389964 28/100 (28%)
Arrestin_C 147..275 CDD:214976 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.