DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-24

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_510328.2 Gene:arrd-24 / 185991 WormBaseID:WBGene00009852 Length:346 Species:Caenorhabditis elegans


Alignment Length:348 Identity:91/348 - (26%)
Similarity:156/348 - (44%) Gaps:54/348 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YA-GQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTE--HDPDDQSNGESFNGHVDYLATRA 78
            || ||.::||||:::.:..:.:.:.:.|.|.|.|.|::.|  :..:.:...||:...|.|.|...
 Worm    17 YAPGQTVTGQVVLRSNEPITARFLKICIHGAAHTKWSEGERRYRTNCEGKEESYTEIVHYSAEVD 81

  Fly    79 YLHG-----SSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDLNFN 138
            |:.|     |:.:....:..|...:.||..|||.||.||||..|.:||.|.|...|||||:.|..
 Worm    82 YVSGETIAWSARNGTEKLPSGHHVFPFAFPLPIECPPSFEGFHGHVRYSVRVELDRPWKFNKNER 146

  Fly   139 RCFTVIKVMDLNSESLMLRVPSQVESQR----TFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEV 199
            ..|.||...|||...|. .||..::..:    .|     :...:::.:::|::|:.||:.:|:.:
 Worm   147 EDFKVIPNFDLN
HLPLG-NVPRMMKDVKDIGQIF-----KKGIVTITVTIPKAGYAPGEYLPITI 205

  Fly   200 MVSNDSGVAVEDITVKLTMVVIYYSQPPSA---------DTNKDRFEMVLKTGGG--VSTKCRQQ 253
            .:.|.|..|...:..:|.....|.:.....         :.:||..:.:.:....  ::.|...:
 Worm   206 DIDNASKRAATFVRAELHQHSHYNASKNHGLLCTHSSYHEHHKDESKRIAEARKSIKIAPKTAGR 270

  Fly   254 FTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHG---------GQSLH--MPITIGSVPLT 307
            ....:|:|.:|||..:  .||.|.|          |..         ..:||  ..|.||:||:|
 Worm   271 EMLRMKIPKSPPTFTS--PIISIEY----------CLSVRLDTLTTLNNTLHCEFDIIIGTVPIT 323

  Fly   308 KQLQKEPRTWGEVLPP--QQLDA 328
            :.:.:...|.....||  ::||:
 Worm   324 ESIVEPTVTTFPSDPPVLERLDS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 49/140 (35%)
Arrestin_C 174..306 CDD:214976 29/153 (19%)
arrd-24NP_510328.2 Arrestin_N 7..158 CDD:334019 49/140 (35%)
Arrestin_C 180..321 CDD:214976 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm4733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.