DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-6

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001254290.1 Gene:arrd-6 / 185541 WormBaseID:WBGene00009579 Length:469 Species:Caenorhabditis elegans


Alignment Length:473 Identity:95/473 - (20%)
Similarity:180/473 - (38%) Gaps:106/473 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETH-------WADTEHDPDDQSNGESFNG 69
            ::.::|||:.|||.|:::..:...::.:.:.::|  :.|       ..:.....|||.       
 Worm    39 NKDVYYAGETISGSVLLENTENIKIRGIRVLLRG--KVHATLKVVKSGERRTLKDDQY------- 94

  Fly    70 HVDYLATRAYLHG-----SSSSIEVLIEPGTSSYRFACQLP-ITCPSSFEGTLGRIRYLVNVRFV 128
               .|..:..|.|     .|.|:.:|.. |...:.|...|| .:.|.|.|.....|||...|...
 Worm    95 ---VLDEKQLLWGKDKSDESDSVPILAR-GVHQFSFNFDLPQSSLPCSLESRHCTIRYYFKVIID 155

  Fly   129 RPWKFDLNFNRCFTVI-KVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPG 192
            .|:.......:.||:| ..:|...|..:  .|...:.::..||:.|:...|::|:.:.::.:|.|
 Worm   156 IPYASSPQGIKYFTIIGPH
IDSMEEKYL--SPLSAQDRKVNCCWCCQRGALALRIILERTAYVCG 218

  Fly   193 QIVPVEVMVSNDSGVA-------VEDITV-----------KLTMVVIYYSQPPSADTNKDRFEMV 239
            :.:.|...:.|....|       |:.:.|           .::.||..:..|..|..::.:::..
 Worm   219 ENIRVRAQIENRQSTAQSLVIRLVQHVEVFVEKGLLGENKMMSCVVFEHKSPAIAANSQGKYDST 283

  Fly   240 LKTGGGVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGC----HGGQSLHM--P 298
            |:.              .:::|..|||...:|.:|||.|.:..      |    .|.:.||:  |
 Worm   284 LEQ--------------PIRLPVVPPTLVGVCRLIQIYYALRV------CMEDEKGNECLHIDFP 328

  Fly   299 ITIGSVPLTKQLQKEPRTWGEVLPPQQLD-----------AKALILIGSEQNGEALGSPNPWAAD 352
            :|:.::|.  ::...|.      ||...|           ......:|...:||  |.......:
 Worm   329 LTVATIPY--RIPNAPP------PPVDYDFCSNHVEGGKYVSPEFRLGQVYDGE--GEEINKEEE 383

  Fly   353 PSIAPPSYAE-------AKHISPD--PHKFSKSKKKSQKRGVKGSQERKAETIVFS-PLYAVFDL 407
            ..:..|.|.:       :.|:|.|  ...|::....|.....:.:..|:...:|.| |..|:.|.
 Worm   384 IVLYRPVYVKLADRRIGSPHVSKDFRSGSFTRIADSSLALVTEPNGSRRRSILVASNPCLAMRDE 448

  Fly   408 SNQVDEMTLRANEPKTDG 425
            |  :||..:..|...::|
 Worm   449 S--MDEKLMMTNGCNSEG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 34/151 (23%)
Arrestin_C 174..306 CDD:214976 29/155 (19%)
arrd-6NP_001254290.1 Arrestin_N 34..174 CDD:278754 33/147 (22%)
Arrestin_C 201..336 CDD:214976 29/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.