DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and ttm-2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_494855.1 Gene:ttm-2 / 184995 WormBaseID:WBGene00017840 Length:358 Species:Caenorhabditis elegans


Alignment Length:356 Identity:72/356 - (20%)
Similarity:130/356 - (36%) Gaps:92/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FY-AGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNG--------------- 64
            || .||.|.|.||.:......:..|...:.|..:..   .:..|:...||               
 Worm    15 FYQPGQTIQGHVVCEPHHPLEIDCVEGRLHGEIQYF---QQLPPNHNRNGSPLPPSKTRVLIDEK 76

  Fly    65 --------------------ESFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCP 109
                                |:.|.|....:..|    ||||:...    .:::....:||...|
 Worm    77 AQLWKYQTVSEMLGLDVFYDENQNRHFSSESASA----SSSSLFTT----AATFPIQIELPHFAP 133

  Fly   110 SSF--EGTLGRIRYLVNVRFVRPWKFDLNFNRCFTVI----KVMDLNSESLMLRV-PSQVESQRT 167
            .||  .|:...||:.:.::.         :|:.|.:.    .::.||.||:..:| |..|..|:|
 Worm   134 PSFYCPGSPVSIRFTLEIQL---------YNQGFKIASHEENLVVLNYESIKRQVTPKPVNFQKT 189

  Fly   168 FCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSA-DT 231
            | .|| :...:|:.:.:|...|.....:...:.:.|....:::.:.:.:...:...:|.... ||
 Worm   190 F-NFP-KERSISLEMLLPTDVFTTTARLENCITICNRWKQSLKYVHLNIVRRISALNQNNEVIDT 252

  Fly   232 NKDRFEMVLKTGGGVSTKCR----QQFTF--DLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCH 290
            .|     :..||.|:.:|.:    :.::|  ...||..||.       |.:....:.|..:|...
 Worm   253 VK-----IDTTGVGLPSKTKIAVGETYSFRPTFNVPALPPN-------IHVNGLFKTEYSLKVTI 305

  Fly   291 GG------QSLHMPITIGSVPLT--KQLQKE 313
            |.      .|..:||||.::..:  :.:|||
 Worm   306 GRAHNFVLASYEVPITIVTMDQSSRRSMQKE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 31/175 (18%)
Arrestin_C 174..306 CDD:214976 26/144 (18%)
ttm-2NP_494855.1 Arrestin_N 7..149 CDD:389964 29/144 (20%)
Arrestin_C <231..326 CDD:383149 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.