DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-14

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496881.1 Gene:arrd-14 / 175021 WormBaseID:WBGene00011055 Length:356 Species:Caenorhabditis elegans


Alignment Length:331 Identity:74/331 - (22%)
Similarity:123/331 - (37%) Gaps:67/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFYAGQLISGQVVIKTEKEKSVKAVILNIKG------------------YAETHWADTEHD---P 58
            :::.|..:.|:..:.|.|.....:|.:...|                  ..|..:.:.:|:   |
 Worm    16 VYFPGDEVKGRAWVSTTKNLKATSVEITFSGKTITAHNGKKIIKDKKCKKGEETYVEMKHEVWTP 80

  Fly    59 DDQSNGESFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLV 123
            :|..|                          ....|...:.|:.:||..||.||||..|.|||.|
 Worm    81 EDTEN--------------------------TFPSGDYEWNFSFELPKDCPPSFEGKYGFIRYSV 119

  Fly   124 NVRFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFC-CFPC---RSSPLSMRLSV 184
            .:....|....:|..|..||..::|||:.:........|::...:| |.||   |.:.: ..|..
 Worm   120 LLHIAVPNGKPINVERAVTVSSMVDLN
AVNAHEPAKIHVDNVAEYCHCLPCLPTRGNVI-YTLQS 183

  Fly   185 PQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQ----------PPSADTNKDRF-EM 238
            |:.|:|.|:.|.|...:.|.:...::.||.|||..:.|..:          ...||..|.:. |.
 Worm   184 PKCGYVAGENVIVSGQIENGTSKPMKIITAKLTRRITYREELKAKANAKKKADGADGFKSKLEEQ 248

  Fly   239 VLKT---GGGVSTKCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPIT 300
            :|:|   ...|..:..:.|.|...:|....| .....::.:.|.|........|:.|....:.|.
 Worm   249 ILETKIERCNVPARSSKDFAFSFDIPAVVST-IRSSRLLAVEYFVTVWGDTGTCNRGGVAALNII 312

  Fly   301 IGSVPL 306
            :|:|||
 Worm   313 VGNVPL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 32/155 (21%)
Arrestin_C 174..306 CDD:214976 33/145 (23%)
arrd-14NP_496881.1 Arrestin_N 6..146 CDD:334019 32/155 (21%)
Arrestin_C 173..318 CDD:214976 33/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.