DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-10

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001364600.1 Gene:arrd-10 / 174936 WormBaseID:WBGene00010268 Length:401 Species:Caenorhabditis elegans


Alignment Length:374 Identity:59/374 - (15%)
Similarity:122/374 - (32%) Gaps:121/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRI--RYLVNVRFVRPWK 132
            |:.:.|.:.   .::..|:|:.| |.........:|...|.:|.|..|.|  |:|:.::..|...
 Worm    66 HIPFTAIQL---PTTKGIDVIPE-GHHRLPIFLNVPHHMPGTFNGKFGAIVYRFLIKLKVKRFSS 126

  Fly   133 FDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLS------------------ 179
            .|.....|...:.|:...|          :|.|.:|      :.|:|                  
 Worm   127 GDEGTIECEKAVDVLGRIS----------LEQQPSF------AQPVSIDRHVKKKAFFMNRLEAH 175

  Fly   180 MRLSVPQSGFVPGQIVPVEVMVSNDS-GVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTG 243
            ::..:.::.:..|..:.|...:.|:. ...::.:.::|...::|    .|.|..:....::.:..
 Worm   176 IKFEIERAAYSVGDHILVTGEIKNEHLSNPIKHVALELRQHILY----ASGDAQRSDTRLITRLI 236

  Fly   244 GGVSTKCRQQFTFDLKVPPT-----------PPTCFNLCSIIQIGYQVEAEARV----KGCHGGQ 293
            .|             .||||           |..|:.  |::..|..|:....:    .||.   
 Worm   237 LG-------------SVPPTETFAVFHSFQVPFDCYP--SLVWNGNPVQVTYELLLTNSGCF--- 283

  Fly   294 SLHMPITIGS------------VPLTKQLQKEPRTWGEVLPPQQLDAKALILIGSEQNGEALGSP 346
            .:..|:.:|:            .|.:...:..|.|....:||.::....              .|
 Worm   284 EIGTPVFLGNYGSPNSTRRSIMYPESTSGEAPPSTTYYCVPPSEMSFTV--------------DP 334

  Fly   347 NPWA-----ADPSIAP------------PSYAEAKHISPDPHKFSKSKK 378
            .|::     .||...|            |:|...::..|..:.|:.:::
 Worm   335 PPYSTFGAKTDPVFIPIHMLKTPYRPFAPAYHMFRNHGPPKYDFNSNQR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 18/81 (22%)
Arrestin_C 174..306 CDD:214976 23/177 (13%)
arrd-10NP_001364600.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.