DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-4

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496120.1 Gene:arrd-4 / 174540 WormBaseID:WBGene00014159 Length:340 Species:Caenorhabditis elegans


Alignment Length:381 Identity:83/381 - (21%)
Similarity:144/381 - (37%) Gaps:72/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETH---WADTEHDPDDQSNGES 66
            :|.|...|:. :|.|..:.|.||:..:.....:.|.:..:|.:||:   |.|.....|       
 Worm     9 DISFDKQSEP-YYPGDTVKGTVVLTNKTPLDARCVTIKCRGKSETYLINWTDLYCKKD------- 65

  Fly    67 FNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPW 131
                   |..::.:...|...:..:..|...:.|..:|||.||.:.||..|...|.|.|...|||
 Worm    66 -------LFRKSEMVWVSKDGQNKMPEGGYIWTFEIKLPIDCPPTHEGYAGGTNYKVKVEIDRPW 123

  Fly   132 KFDLNFNRCFTVIKVMDLNSE------SLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFV 190
            |.::...:...|.:.:|:..:      :....:.|.:.|.         :.|:|:::|||...|.
 Worm   124 KCNIREEKEIMVTRKLDI
EKKWDQDGYTFTSNLRSGIFSS---------NGPISLKVSVPTLVFR 179

  Fly   191 PGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPP-----SADTNKDRFEMVLKTGGGVSTKC 250
            .||.......|.|.|...:.:|.:|....|.|:|:..     ..|::.....:..:|.   |:.|
 Worm   180 QGQTAEFHFEVKNHSSSTINEIFIKFGKQVHYHSRNQLTPCRKFDSHSCPLSVYHQTN---SSNC 241

  Fly   251 RQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIG---SVPLTKQLQK 312
            ..:.| .|||...|   ::..||| :.:.:..||:......|.     :..|   ...:..:|..
 Worm   242 IGEAT-ALKVNVAP---YSTKSII-LPFTIPEEAKTPSFSTGL-----VNFGYFMEFGIVTKLIV 296

  Fly   313 EPRTWGEVLPPQQLDAKALILIGSEQNGEALGSPN------PWAADPSIAPPSYAE 362
            :||            .:|.|.:|........|..:      ....:.|.|||:|:|
 Worm   297 QPR------------MRATIYVGEMPVDNVTGKDDEKLKKIKQILESSGAPPAYSE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 36/147 (24%)
Arrestin_C 174..306 CDD:214976 32/139 (23%)
arrd-4NP_496120.1 Arrestin_N 8..141 CDD:334019 35/146 (24%)
Arrestin_C 163..310 CDD:367164 38/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.