DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrd-2

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_496008.1 Gene:arrd-2 / 174491 WormBaseID:WBGene00013086 Length:334 Species:Caenorhabditis elegans


Alignment Length:379 Identity:82/379 - (21%)
Similarity:148/379 - (39%) Gaps:75/379 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGH 70
            |.|.|.|: .:..|..:||:|::.|:...|.:.:.:..||.::.::..:|.....:....:|.|.
 Worm     5 IVFSNPSK-TYLPGDYVSGKVLLTTKDPISARYMEITWKGESKCNFGGSESSNVQRHLAGTFMGW 68

  Fly    71 VDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVRFVRPWKFDL 135
            :           :...::. |..||...||..:||...|.||.|..|.|.|.|.|.|.|||:..|
 Worm    69 I-----------AKDGVDT-IPAGTLKSRFRFRLPENSPPSFCGMFGEIEYSVTVEFDRPWRLKL 121

  Fly   136 NFNRCFTVIKVMDLN-SESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQIVPVEV 199
            .....|.|::..:|. ||..|::....|:|:.:...|  :.....::|...:..|:.|:.:....
 Worm   122 KMMNTFRVVQKTNL
TLSEPKMMKYAEFVKSKNSGTIF--KDGLFLLKLHFSKRAFLAGETIRALA 184

  Fly   200 MVSNDSGVAVEDITVKLTMVVIYYSQPPSA-----DTNKD-----RF----EMVLKTGGGVSTKC 250
            ::.|.|...:.::..:|.....|:|:|..:     |.:.|     ::    |.||:   |.:..|
 Worm   185 IMENHSTKPIINLRFELIQQSHYHSRPQKSLCSLNDCHSDCPIESKYRRDGETVLR---GANYSC 246

  Fly   251 R------QQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQ 309
            .      :....::.:|...|..|. ..:|.:||               .|...:..||      
 Worm   247 DVAPGEVKYINVEIDLPNGLPPTFE-SPMISMGY---------------LLGFTLRNGS------ 289

  Fly   310 LQKEPRTWGEVLPPQQLDAKALILIGSEQN-GEALGSPNPWAADPSI--APPSY 360
                       |...:|...|.|::|||:. .|.:....|......:  :||.|
 Worm   290 -----------LTGNRLACNARIVVGSEETIDEMVDECEPTKKSQCLTASPPPY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 38/143 (27%)
Arrestin_C 174..306 CDD:214976 25/151 (17%)
arrd-2NP_496008.1 Arrestin_N 3..135 CDD:389964 38/142 (27%)
Arrestin_C 159..305 CDD:367164 29/181 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.