DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Txnip

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001008767.1 Gene:Txnip / 117514 RGDID:620886 Length:394 Species:Rattus norvegicus


Alignment Length:378 Identity:79/378 - (20%)
Similarity:144/378 - (38%) Gaps:55/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNG 69
            |:.| |:.:.::.:|:.::|:|.::..:...||||.:...|.|:..|         ....:....
  Rat    11 EVVF-NDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLW---------MQGSQQCKQ 65

  Fly    70 HVDYLATRAYL----HGSSSSIEVLIEPGTS-SYRFACQLPI-TCPSSFEGTLGRIRYLVNVRFV 128
            .:|||.....|    ..:..:..|::.||.. .|:|..:||. ...:||:|..|.:.|.|.....
  Rat    66 TLDYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLD 130

  Fly   129 RPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQ 193
            ||.:......:.|.|:.::|:|:..||  .|...:.::...|.......:|:...:.:.||..|.
  Rat   131 RPSQPTQEAKKNFEVMDLVDVN
TPDLM--APVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGD 193

  Fly   194 IVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGG--VSTKCRQQFTF 256
            .:.:.....|    ....|.|....:|..::...:..| |...:.:....|.  :|..|......
  Rat   194 DISIHADFEN----TCSRIVVPKAAIVARHTYLANGQT-KVLTQKLSSVRGNHIISGTCASWRGK 253

  Fly   257 DLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVP--LTKQLQKEPRTWGE 319
            .|:|....|:... |:|:::.|.:.....|.|.. ...|.:|:.|||..  .::......||   
  Rat   254 SLRVQKIRPSILG-CNILRVEYSLLIYVSVPGSK-KVILDLPLVIGSRSGLSSRTSSMASRT--- 313

  Fly   320 VLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSIAPPSYAEAKHISPDPHK 372
                           .||.:...|..|     |...|||.|.:   :.|:.|:
  Rat   314 ---------------SSEMSWIDLNIP-----DTPEAPPCYMD---VIPEDHR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 35/150 (23%)
Arrestin_C 174..306 CDD:214976 26/135 (19%)
TxnipNP_001008767.1 Arrestin_N 10..152 CDD:304627 35/150 (23%)
Arrestin_C 174..298 CDD:280848 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm12328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.