DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and Arrdc3

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001036056.1 Gene:Arrdc3 / 105171 MGIID:2145242 Length:414 Species:Mus musculus


Alignment Length:417 Identity:102/417 - (24%)
Similarity:184/417 - (44%) Gaps:59/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CNNSQG--IFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGESFNGHV 71
            |.|...  ::.:|..:||:|.::...|..||::.::.:|:|:..|.::.:...:.:..:::...|
Mouse    15 CLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTAYTQNYTEEV 79

  Fly    72 DYLATRAYLHG----SSSSIEVL--IEPGTSSYRFACQLPIT-CPSSFEGTLGRIRYLVNVRFVR 129
            :|...:..|.|    ..:|.|..  |..|...|.|:.:||.| ..:||||..|.:||.|.....|
Mouse    80 EYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHR 144

  Fly   130 PWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVPGQI 194
            ||...:...:.|||.:.:|:|:.||:  .|.....::|.||:.|.|.|:|:...:.:.|:.||:.
Mouse   145 PWLLPVKLKKEFTVFEHIDINTPSLL--SPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGES 207

  Fly   195 VPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTFD-- 257
            :.:...:.|.|...|      :....||.:|...|.......:.::....|.|....:..|::  
Mouse   208 IQIFAEIENCSSRMV------VPKAAIYQTQAFYAKGKMKEVKQLVANLRGESLSSGKTETWNGK 266

  Fly   258 -LKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPL------TKQLQKE-- 313
             ||:||..|:..: ||||::.|.:.....:.|.. ...|.:|:.||::||      |..:..:  
Mouse   267 LLKIPPVSPSILD-CSIIRVEYSLMVYVDIPGAM-DLLLSLPLVIGTIPLHPFGSRTSSVSSQCS 329

  Fly   314 ----------------PRTWGEVLPPQQLDAKALILIGSEQNGE-ALGSP-----NPWAADPSIA 356
                            |.::.||:..:| ....|..:|:..:.| ||..|     ..:...|   
Mouse   330 MSMNWLALALPERPEAPPSYAEVVTEEQ-RRNNLAPVGACDDFERALQGPLFAYIQEFRFLP--- 390

  Fly   357 PPSYAEAKHISPDPHKFSKSKKKSQKR 383
            ||.|:|   |.|:|.:.|:.:.....|
Mouse   391 PPLYSE---IDPNPDQSSEDRPSCPSR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 40/149 (27%)
Arrestin_C 174..306 CDD:214976 31/134 (23%)
Arrdc3NP_001036056.1 Arrestin_N 22..165 CDD:278754 38/142 (27%)
Arrestin_C 187..314 CDD:214976 31/134 (23%)
PPxY motif 1. /evidence=ECO:0000305 346..349 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 391..394 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7292
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.