DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18746 and arrdc1a

DIOPT Version :9

Sequence 1:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_005171840.1 Gene:arrdc1a / 100006005 ZFINID:ZDB-GENE-030925-15 Length:447 Species:Danio rerio


Alignment Length:448 Identity:96/448 - (21%)
Similarity:168/448 - (37%) Gaps:111/448 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYA-------ETHWADTEHDPDDQS 62
            ||.|.|| :.::..|:.::|.:.|...:....||:.:|.:|:.       :|.|.|.|.      
Zfish     8 EITFDNN-KTVYSPGESLTGTLKISIAQSIQCKAIKVNCQGFCGVTSKSNDTDWTDEEQ------ 65

  Fly    63 NGESFNGHVDYLATRAYLHGSSSSIEV----LIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLV 123
                            |.   |||:.:    .::.|..|:.|...||...|:||.|..|:|.|.|
Zfish    66 ----------------YF---SSSVSIADKGTLKEGEHSFPFKFLLPAAAPTSFVGPYGQIMYRV 111

  Fly   124 NV-----RFVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLS 183
            ..     ||.:.:|.:    :.|::...::|| |...:|.||.....:.|.....::..:.:...
Zfish   112 RAFIDTPRFAKDYKIE----KPFSMTNTLNLN
-EVPGIREPSSSSVTKNFSYMLVKNGTVVLNAK 171

  Fly   184 VPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVST 248
            ....|::.|||:.|...:.|.|......:...|...|.|.::.|:.|..    .:....|.||..
Zfish   172 TDMRGYIAGQIIKVSAGIENKSDKTTGHVVASLMQKVTYNTKKPTYDLR----SVAEVEGPGVKG 232

  Fly   249 KCRQQFTFDLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKE 313
            ..:.::...:.||..|.:..:..::|||.|.::...:    :...:|.:||.||||.|.......
Zfish   233 GNKSEWNQQIIVPALPHSSLSDGNLIQICYYIQVYLK----YPEVALTLPICIGSVALDPSQPSH 293

  Fly   314 --------------------PRTWGEVLPPQ---------------------QLDAKALILIGSE 337
                                |.:....|||:                     .:|....:...|.
Zfish   294 SQTVAPMPAPRITPAPSPSAPESEASNLPPRPAPKPAPKPRPRSTHASPSAPPVDLYPQLPSVSN 358

  Fly   338 QNGEALGSPN--PWAADPSIAPPSYAEAKHIS------------PDPHKFSKSKKKSQ 381
            .|||.|.||:  |.:..| ::|.:::.|..:|            |.|...|.|:.::|
Zfish   359 YNGEMLKSPHQEPGSQGP-VSPNAFSYAPGLSFRQRQSSSGPSAPPPSLSSSSQDRNQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 37/160 (23%)
Arrestin_C 174..306 CDD:214976 29/131 (22%)
arrdc1aXP_005171840.1 Arrestin_N 7..139 CDD:304627 37/160 (23%)
Arrestin_C 162..283 CDD:280848 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.