DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ARRDC1

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006717383.1 Gene:ARRDC1 / 92714 HGNCID:28633 Length:466 Species:Homo sapiens


Alignment Length:451 Identity:87/451 - (19%)
Similarity:133/451 - (29%) Gaps:196/451 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFDYRVDYFAKIDYFVGS-EAAQPQI 97
            |.|:..|:.:.|.::            |.|:...||:.             .||..| ..|....
Human    46 AAIRVTCIGSCGVSN------------KANDTAWVVEE-------------GYFNSSLSLADKGS 85

  Fly    98 MEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLIHSSADRPLEVLHVRQLQIFPQNSLSQET 162
            :.||.:::.|...||...|.:|||..|.|.:.::..||:                 |:.|   :.
Human    86 LPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHT-----------------PRFS---KD 130

  Fly   163 RSCEIQIYEQTP------------RLRFWMKPLH---------------------------LQLQ 188
            ..|.:..|..:|            .||...|||.                           |...
Human   131 HKCSLVFYILSPLNLNSIPDIEGSSLRTPAKPLPGPPPKQPNVASATKKFSYKLVKTGSVVLTAS 195

  Fly   189 IPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSR-- 251
            ...:||..|..:.:|..:.|.........|.||:|..:|.|.......|...:||...|.:.|  
Human   196 TDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRA 260

  Fly   252 --HELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPVI 314
              ||...:|             .:||:|    :.||:.:.::|.::|.:...:    ....:||.
Human   261 QWHEQILVP-------------ALPQSA----LPGCSLIHIDYYLQVSLKAPE----ATVTLPVF 304

  Fly   315 IGNV------TPPCPGKLL-----------------------------------------MQEPI 332
            |||:      ..|.||..|                                         .::|:
Human   305 IGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPL 369

  Fly   333 DGT------APEPTP-------------------------------PVETASTLI--PNFS 354
            ..|      ||||.|                               ||.|.||||  |.:|
Human   370 LATLSSVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 25/107 (23%)
Arrestin_C 179..322 CDD:214976 35/179 (20%)
ARRDC1XP_006717383.1 Arrestin_N <70..146 CDD:304627 22/108 (20%)
Arrestin_C 186..307 CDD:280848 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.